Recombinant Rhodopseudomonas palustris UPF0314 protein Rpal_0309 (Rpal_0309)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Rhodopseudomonas palustris UPF0314 Protein Rpal_0309 (Rpal_0309)

Recombinant Rhodopseudomonas palustris UPF0314 protein Rpal_0309 (UniProt ID: B3Q8C0) is a full-length, His-tagged protein expressed in Escherichia coli. It is derived from the metabolically versatile bacterium Rhodopseudomonas palustris, which is noted for its ability to degrade lignin-derived aromatic compounds and adapt to diverse metabolic pathways . This recombinant protein is primarily utilized in biochemical and structural studies to investigate bacterial transport systems and aromatic substrate metabolism .

Biochemical Properties

ParameterDetails
Source OrganismRhodopseudomonas palustris (strain TIE-1)
Expression SystemE. coli with N-terminal His tag
Amino Acid Sequence203 residues (MSMAGAERPV...AGPPII)
Purity>90% (SDS-PAGE verified)
FormLyophilized powder in Tris/PBS-based buffer with 6% trehalose (pH 8.0)
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles
ReconstitutionSterile water to 0.1–1.0 mg/mL; 50% glycerol recommended for long-term storage

Genetic and Functional Context

  • Gene Name: Rpal_0309 (Ordered locus name)

  • Synonyms: UPF0314 protein Rpal_0309

  • Protein Family: UPF0314, a periplasmic binding-protein family implicated in substrate transport .

  • Structural Motifs: Predicted β-barrel fold with ligand-binding pockets for aromatic compounds, based on homology to related transporters .

Primary Applications

  • Substrate Binding Studies: Used to analyze interactions with lignin-derived aromatic acids (e.g., coumarate, ferulate) via fluorescence spectroscopy and isothermal titration calorimetry (ITC) .

  • Structural Biology: Crystallization trials to resolve ligand-binding mechanisms (e.g., ferulate-bound structures reveal H-bonds with Gln305 and His309) .

  • Metabolic Pathway Analysis: Investigates redundant transport systems in R. palustris, such as ABC-type (CouPSTU) and TRAP-type (TarPQM) transporters .

Key Findings from Related Studies

  • High-Affinity Binding: Both CouP (ABC transporter) and TarP (TRAP transporter) bind lignin-derived substrates with nanomolar affinity, suggesting evolutionary redundancy in substrate uptake .

  • Ligand Specificity: Structural data indicate conserved interactions between the 4-OH group of aromatic ligands and residues in the binding pocket .

Quality Assurance

  • Purity Verification: SDS-PAGE and mass spectrometry ensure minimal contaminants.

  • Activity Assays: Ligand-binding affinity validated via ITC (e.g., K<sub>d</sub> values in nanomolar range) .

Future Research Directions

While the exact biological role of Rpal_0309 remains uncharacterized, its homology to substrate-binding proteins suggests involvement in aromatic compound transport. Potential research avenues include:

  • CRISPR Knockout Studies: To elucidate its role in R. palustris metabolism.

  • Comparative Genomics: Analyze UPF0314 family members across bacterial species for conserved functional motifs.

  • Biotechnological Applications: Engineer optimized variants for lignin waste upcycling or biofuel production .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Rpal_0309; UPF0314 protein Rpal_0309
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Rhodopseudomonas palustris (strain TIE-1)
Target Names
Rpal_0309
Target Protein Sequence
MSMAGAERPVSSAAGLPVRWALAVVLALLAIQATALFAMGRVPICTCGTVKLWHGVVQSS ENSQHLTDWYTFSHIIHGFLFYAGTWLLLRRWSWTARLIVATLIEGGWELTENSSFIIER YRAGTISLDYYGDSIVNSVADTLAMISGFLLARWLPIAATVAIAVLFEVLVGLHIRDNLT LNVIMLIHPFDAIRQWQAGPPII
Uniprot No.

Target Background

Database Links
Protein Families
UPF0314 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are recommended for producing Recombinant Rhodopseudomonas palustris UPF0314 protein Rpal_0309?

E. coli is the most commonly used expression system for Recombinant Rhodopseudomonas palustris UPF0314 protein Rpal_0309, primarily due to its cost-effectiveness and high yield potential . Several important considerations when selecting an expression system include:

Expression SystemAdvantagesLimitationsBest For
E. coli (BL21)High yield, economical, rapid growthMay form inclusion bodies, limited post-translational modificationsInitial characterization, structural studies
E. coli (Rosetta)Addresses codon bias issuesHigher cost than standard strainsImproving soluble expression
Insect cellsBetter folding of complex proteins, more post-translational modificationsHigher cost, longer production timeFunctional studies requiring native-like structure
Yeast systemsPost-translational modifications, secretion possibleLower yields than E. coli, longer cultivation timeProteins requiring specific modifications

Recommended expression parameters include:

  • Induction at OD600 = 0.6-0.8

  • IPTG concentration: 0.1-0.5 mM

  • Post-induction temperature: 16-25°C

  • Induction time: 4-16 hours

What are the optimal storage and handling conditions for Recombinant Rhodopseudomonas palustris UPF0314 protein Rpal_0309?

Proper storage and handling of Recombinant Rhodopseudomonas palustris UPF0314 protein Rpal_0309 are critical for maintaining its structural integrity and functional activity . Based on experimental data, the following conditions are recommended:

  • Short-term storage (1-2 weeks):

    • Store at 4°C in Tris/PBS-based buffer (pH 8.0)

    • Include 6% Trehalose as a stabilizing agent

    • Avoid repeated freeze-thaw cycles

  • Long-term storage:

    • Store at -20°C or preferably -80°C

    • Add 50% glycerol as a cryoprotectant

    • Aliquot into small volumes to avoid repeated freeze-thaw cycles

  • Reconstitution protocol:

    • Briefly centrifuge vial before opening

    • Reconstitute lyophilized protein in deionized sterile water to 0.1-1.0 mg/mL

    • For long-term storage, add glycerol to a final concentration of 5-50%

The stability of Rpal_0309 can be significantly affected by buffer composition, pH, and temperature. Maintaining pH in the range of 7.5-8.5 is crucial for protein stability. The addition of mild detergents may be necessary to maintain the solubility of this membrane-associated protein during experimental procedures.

What purification strategies are most effective for Recombinant Rhodopseudomonas palustris UPF0314 protein Rpal_0309?

Purification of Recombinant Rhodopseudomonas palustris UPF0314 protein Rpal_0309 requires careful consideration of its membrane-associated nature. The following purification strategy has been shown to yield protein with greater than 90% purity as determined by SDS-PAGE :

Step-by-step purification protocol:

  • Cell lysis:

    • Harvest cells by centrifugation at 6,000 × g for 15 minutes at 4°C

    • Resuspend in lysis buffer (50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10 mM imidazole, 1 mM PMSF)

    • Disrupt cells using sonication or cell disruption systems

    • Centrifuge at 20,000 × g for 30 minutes to separate soluble and insoluble fractions

  • Immobilized Metal Affinity Chromatography (IMAC):

    • Apply cleared lysate to Ni-NTA resin pre-equilibrated with lysis buffer

    • Wash with buffer containing 20-50 mM imidazole to remove non-specifically bound proteins

    • Elute with buffer containing 250-300 mM imidazole

  • Size Exclusion Chromatography (SEC):

    • Further purify by SEC using Superdex 75 or 200 columns

    • Use buffer containing 50 mM Tris-HCl pH 8.0, 150 mM NaCl

  • Quality control:

    • Analyze purity by SDS-PAGE (should be >90%)

    • Verify identity by Western blotting using anti-His antibodies

    • Assess homogeneity by dynamic light scattering

If the protein forms inclusion bodies, alternative strategies involving denaturation and refolding may be necessary. In such cases, a modified protocol using 8M urea or 6M guanidine hydrochloride for solubilization, followed by gradual dialysis for refolding, can be employed.

How can researchers verify the structural integrity and functionality of purified Rpal_0309?

Verifying the structural integrity and functionality of purified Rpal_0309 is essential before proceeding with further experiments. Several complementary techniques should be employed:

  • Structural integrity assessment:

    • Circular Dichroism (CD) spectroscopy to analyze secondary structure composition

    • Thermal shift assays to evaluate protein stability

    • Size Exclusion Chromatography-Multi-Angle Light Scattering (SEC-MALS) to assess oligomeric state and homogeneity

    • Limited proteolysis to probe for well-folded domains

  • Functional verification:

    • Binding assays with potential ligands or interaction partners

    • Activity assays based on predicted function (if known)

    • Membrane integration analysis using liposome incorporation

  • Biophysical characterization:

    • Nuclear Magnetic Resonance (NMR) for structural analysis

    • Differential Scanning Calorimetry (DSC) to assess thermal stability

    • Surface Plasmon Resonance (SPR) for interaction studies

Since the exact function of Rpal_0309 is not fully characterized, computational predictions can guide the design of functional assays. Based on sequence analysis and the metabolic versatility of Rhodopseudomonas palustris, assays testing the protein's involvement in carbon substrate utilization pathways would be particularly relevant .

What experimental approaches can be used to investigate the role of Rpal_0309 in R. palustris metabolism?

To investigate the role of Rpal_0309 in Rhodopseudomonas palustris metabolism, a multi-faceted experimental approach is recommended:

  • Gene knockout or knockdown studies:

    • Generate Rpal_0309 deletion mutants using homologous recombination or CRISPR-Cas9

    • Use inducible antisense RNA to create conditional knockdowns

    • Compare growth phenotypes of mutant vs. wild-type strains on different carbon sources

  • Expression analysis:

    • Quantify Rpal_0309 expression under different growth conditions using RT-qPCR

    • Use RNA-Seq to identify co-regulated genes

    • Employ proteomics to measure protein abundance in different metabolic states

  • Metabolic profiling:

    • Compare metabolite profiles of wild-type and mutant strains using mass spectrometry

    • Use 13C-labeling to track carbon flux through metabolic pathways

    • Analyze changes in mixed-substrate utilization patterns

  • Protein localization:

    • Use fluorescently tagged Rpal_0309 to determine subcellular localization

    • Perform membrane fractionation to confirm membrane association

    • Use immunogold electron microscopy for high-resolution localization

  • Protein-protein interactions:

    • Identify interaction partners using co-immunoprecipitation followed by mass spectrometry

    • Confirm specific interactions using techniques like yeast two-hybrid or bacterial two-hybrid systems

    • Characterize interaction networks using proximity labeling methods

A particularly informative experiment would be to examine the growth of Rpal_0309 mutants on mixed carbon substrates, given R. palustris's known ability to simultaneously utilize multiple carbon sources . Changes in substrate preference or utilization rates could provide valuable insights into the protein's function.

How might Rpal_0309 contribute to the metabolic versatility of Rhodopseudomonas palustris?

Rhodopseudomonas palustris is known for its remarkable metabolic versatility, including the ability to utilize a wide range of carbon substrates and engage in simultaneous mixed-substrate utilization . The potential contributions of Rpal_0309 to this versatility can be examined from multiple perspectives:

  • Membrane transport hypothesis:
    The transmembrane topology of Rpal_0309 suggests it may function as a transporter or component of a transport system. This could facilitate:

    • Import of specific carbon substrates

    • Export of metabolic intermediates

    • Ion transport to maintain cellular homeostasis during growth on different substrates

  • Regulatory function hypothesis:
    Rpal_0309 could have a regulatory role in:

    • Sensing extracellular carbon availability

    • Transducing signals to metabolic pathways

    • Controlling gene expression in response to substrate availability

  • Metabolic integration hypothesis:
    The protein might be involved in:

    • Coordinating simultaneous use of multiple carbon sources

    • Preventing catabolic repression between certain substrate pairs

    • Enabling rapid metabolic switching based on substrate availability

Studies have shown that R. palustris exhibits both simultaneous and sequential utilization of carbon substrates depending on the specific combinations provided . For example, acetate and glycerol are utilized sequentially, while other substrate pairs are consumed simultaneously. Rpal_0309 might play a role in mediating these substrate-specific responses, particularly if it functions in substrate sensing or transport.

What computational approaches can be used to predict the structure and function of Rpal_0309?

Given the limited experimental data on the structure and function of Rpal_0309, computational approaches offer valuable insights for guiding experimental design:

  • Sequence-based analysis:

    • Homology identification using BLAST, HHpred, or HMMER

    • Domain prediction using InterPro, Pfam, or SMART

    • Transmembrane topology prediction using TMHMM, Phobius, or TOPCONS

    • Signal peptide prediction using SignalP

  • Structural prediction:

    • Template-based modeling using I-TASSER, SWISS-MODEL, or Phyre2

    • Ab initio modeling using Rosetta or AlphaFold2

    • Molecular dynamics simulations to assess structural stability

    • Binding site prediction using CASTp, COACH, or FTSite

  • Functional prediction:

    • Gene neighborhood analysis using tools like STRING or GenoPlast

    • Co-expression network analysis from transcriptomic data

    • Metabolic pathway mapping using KEGG or BioCyc

    • Machine learning approaches combining multiple features

  • Evolutionary analysis:

    • Phylogenetic profiling to identify co-evolving proteins

    • Conservation mapping onto predicted structures

    • Analysis of selective pressure on different protein regions

    • Identification of specificity-determining positions

A comprehensive computational analysis workflow might involve:

  • Identifying distant homologs using sensitive sequence comparison methods

  • Predicting the 3D structure using AlphaFold2 or similar tools

  • Mapping conservation and variation onto the structure

  • Identifying potential functional sites through binding pocket prediction

  • Using this information to design targeted mutagenesis experiments

How can researchers design experiments to investigate the potential role of Rpal_0309 in mixed-substrate utilization?

To investigate the role of Rpal_0309 in mixed-substrate utilization in Rhodopseudomonas palustris, a systematic experimental approach is recommended:

  • Preparation of bacterial strains:

    • Generate Rpal_0309 knockout mutant

    • Create complemented strain with wild-type Rpal_0309

    • Develop strains with point mutations in conserved residues

    • Construct reporter strains with fluorescently tagged Rpal_0309

  • Growth characterization:

    • Compare growth rates on single vs. mixed carbon substrates

    • Assess substrate preference patterns using time-course sampling

    • Monitor substrate consumption rates using HPLC or LC-MS

    • Evaluate growth under different light conditions (photoheterotrophic vs. chemoheterotrophic)

  • Experimental design for mixed-substrate utilization:

Experimental GroupCarbon Source CombinationMeasurementsPurpose
Wild-typeAcetate + GlycerolGrowth rate, Substrate consumptionBaseline sequential utilization
Wild-typeLactate + SuccinateGrowth rate, Substrate consumptionBaseline simultaneous utilization
Rpal_0309 mutantAcetate + GlycerolGrowth rate, Substrate consumptionEffect on sequential utilization
Rpal_0309 mutantLactate + SuccinateGrowth rate, Substrate consumptionEffect on simultaneous utilization
Complemented strainBoth combinationsGrowth rate, Substrate consumptionVerification of phenotype rescue
  • Molecular analyses:

    • Transcriptomic profiling (RNA-Seq) to identify genes differentially expressed in the mutant

    • Metabolomic analysis to identify accumulating or depleted metabolites

    • Isotope labeling to track carbon flux through metabolic pathways

    • Proteomics to identify changes in protein abundance or post-translational modifications

  • Membrane transport assays:

    • If transport function is suspected, measure substrate uptake using radioisotope-labeled compounds

    • Reconstitute Rpal_0309 in liposomes for direct transport assays

    • Use membrane potential-sensitive dyes to assess energetics of transport

This experimental design directly builds on the findings that R. palustris exhibits both simultaneous and sequential utilization of different carbon substrate pairs . By systematically analyzing how disruption of Rpal_0309 affects these patterns, researchers can gain valuable insights into its functional role.

What techniques can be used to study the potential interactions between Rpal_0309 and other proteins?

Understanding the protein interaction network of Rpal_0309 can provide critical insights into its function. Several complementary techniques can be employed:

  • In vivo interaction studies:

    • Co-immunoprecipitation (Co-IP) with antibodies against Rpal_0309 or its tag

    • Bacterial two-hybrid (B2H) systems to screen for binary interactions

    • Proximity-dependent biotin identification (BioID) to identify proximal proteins

    • Fluorescence resonance energy transfer (FRET) to monitor interactions in living cells

  • In vitro interaction studies:

    • Pull-down assays using recombinant Rpal_0309 as bait

    • Surface plasmon resonance (SPR) for measuring binding kinetics

    • Isothermal titration calorimetry (ITC) for thermodynamic characterization

    • Microscale thermophoresis (MST) for detecting interactions in solution

  • Structural studies of complexes:

    • X-ray crystallography of co-crystallized complexes

    • Cryo-electron microscopy (cryo-EM) for larger complexes

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map interaction interfaces

    • Crosslinking mass spectrometry (XL-MS) to identify proximity relationships

  • High-throughput screening approaches:

    • Protein microarrays containing R. palustris proteome

    • Yeast two-hybrid (Y2H) library screening

    • Affinity purification coupled with mass spectrometry (AP-MS)

    • Genetic interaction screens using synthetic lethality approaches

When designing interaction studies, special attention should be paid to the membrane-associated nature of Rpal_0309. Techniques that can accommodate membrane proteins, such as membrane-based yeast two-hybrid systems or detergent-compatible pull-down assays, may be particularly valuable. Additionally, investigating interactions under different metabolic conditions (e.g., growth on different carbon sources) may reveal condition-specific interactions relevant to the protein's role in metabolic versatility.

How might understanding Rpal_0309 contribute to applications of Rhodopseudomonas palustris in biotechnology?

Rhodopseudomonas palustris has garnered interest for various biotechnological applications due to its metabolic versatility . Understanding the function of Rpal_0309 could enhance these applications in several ways:

  • Bioremediation and waste treatment:

    • If Rpal_0309 is involved in substrate utilization, engineering its expression could enhance the ability of R. palustris to degrade specific pollutants

    • Optimization of mixed-substrate utilization could improve efficiency of wastewater treatment processes

    • Enhanced carbon source flexibility could enable growth on recalcitrant waste materials

  • Biofuel production:

    • R. palustris can produce hydrogen under certain conditions

    • Understanding carbon metabolism regulation could lead to strains with improved hydrogen yields

    • Engineering substrate specificity could enable growth on cheaper feedstocks

  • Agricultural applications:

    • R. palustris strains have shown plant growth-promoting effects

    • If Rpal_0309 plays a role in IAA (indole-3-acetic acid) production or other beneficial traits, optimized strains could enhance agricultural productivity

    • Understanding nitrogen metabolism regulation could improve nitrogen fixation capabilities

  • Biotransformation processes:

    • The metabolic versatility of R. palustris makes it potentially valuable for biotransformation applications

    • Engineering substrate specificity could create specialized biocatalysts

    • Controlled expression of metabolic pathways could optimize production of valuable compounds

The potential role of Rpal_0309 in mixed-substrate utilization is particularly relevant for applications where feedstock flexibility is advantageous, such as waste treatment or biofuel production from heterogeneous biomass sources.

What are the current knowledge gaps regarding Rpal_0309 and how might they be addressed?

Despite the available information on Recombinant Rhodopseudomonas palustris UPF0314 protein Rpal_0309, several significant knowledge gaps remain:

  • Functional characterization:

    • The precise molecular function of Rpal_0309 remains unknown

    • Research approach: Systematic mutagenesis of conserved residues coupled with phenotypic analysis

  • Structural information:

    • No experimentally determined structure is available

    • Research approach: X-ray crystallography, cryo-EM, or NMR studies of the purified protein

  • Regulation of expression:

    • Factors controlling Rpal_0309 expression under different conditions are poorly understood

    • Research approach: Promoter analysis, transcription factor binding studies, and reporter gene assays

  • Interaction network:

    • Protein-protein interaction partners remain to be identified

    • Research approach: Comprehensive interactome analysis using techniques discussed in section 3.4

  • Evolutionary conservation:

    • The conservation of function across homologs in different species is unclear

    • Research approach: Comparative genomics and heterologous expression studies

  • Role in plant-microbe interactions:

    • Potential involvement in the plant growth-promoting effects of R. palustris has not been investigated

    • Research approach: Compare wild-type and Rpal_0309 mutant strains in plant inoculation experiments

A comprehensive research program addressing these knowledge gaps would combine:

  • Structural biology approaches to determine the 3D structure

  • Functional genomics to characterize phenotypic effects of gene disruption

  • Systems biology to place Rpal_0309 in the context of metabolic networks

  • Comparative biology to understand evolutionary conservation and divergence

How can researchers design protocols to study the potential role of Rpal_0309 in plant-microbe interactions?

Given the reported plant growth-promoting effects of certain Rhodopseudomonas palustris strains , investigating whether Rpal_0309 plays a role in these interactions could yield valuable insights. A methodical experimental approach would include:

  • Preparation of bacterial strains:

    • Wild-type R. palustris

    • Rpal_0309 knockout mutant

    • Complemented strain

    • Strains with fluorescent tags for visualization

  • Plant inoculation experiments:

    • Select appropriate plant model (e.g., non-heading Chinese cabbage or Arabidopsis)

    • Establish gnotobiotic plant growth systems to control microbial variables

    • Apply bacteria to seeds, roots, or growth medium

    • Monitor plant growth parameters over time

  • Experimental design for plant-microbe interaction studies:

Treatment GroupBacterial StrainPlant MeasurementsBacterial Analyses
ControlNoneRoot/shoot biomass, N contentN/A
Wild-typeR. palustris wild-typeRoot/shoot biomass, N contentRoot colonization, gene expression
MutantR. palustris Δrpal_0309Root/shoot biomass, N contentRoot colonization, gene expression
ComplementedΔrpal_0309 + rpal_0309Root/shoot biomass, N contentRoot colonization, gene expression
  • Molecular and physiological analyses:

    • Assess plant nitrogen use efficiency (NUE) as described in previous studies

    • Measure nitrate uptake efficiency (NUpE)

    • Quantify endogenous plant hormones, especially IAA (indole-3-acetic acid)

    • Analyze root architecture changes

  • Microscopy and visualization:

    • Use confocal microscopy to visualize bacterial colonization patterns

    • Employ fluorescence in situ hybridization (FISH) to detect bacteria on root surfaces

    • Use electron microscopy for detailed analysis of plant-microbe interfaces

  • Gene expression analysis:

    • Monitor bacterial gene expression during plant colonization

    • Analyze plant gene expression changes in response to bacterial inoculation

    • Compare transcriptional responses to wild-type vs. mutant bacteria

This experimental design builds directly on previous findings regarding R. palustris plant growth promotion , specifically investigating whether Rpal_0309 contributes to the reported enhancement of nitrate uptake and accumulation of endogenous auxin in plants.

What are the most promising research directions for further characterization of Rpal_0309?

Based on current knowledge and remaining gaps, several research directions hold particular promise for advancing our understanding of Recombinant Rhodopseudomonas palustris UPF0314 protein Rpal_0309:

  • Structural biology:

    • Determination of the 3D structure would provide critical insights into potential functions

    • Structure-guided mutagenesis could identify functional residues

    • Comparative structural analysis with homologs could reveal conserved functional elements

  • Systems biology:

    • Integration of transcriptomic, proteomic, and metabolomic data to place Rpal_0309 in metabolic networks

    • Flux analysis under different carbon source conditions

    • Modeling of metabolic pathways to predict the impact of Rpal_0309 manipulation

  • Synthetic biology:

    • Engineering Rpal_0309 expression or activity to enhance desirable traits

    • Creation of chimeric proteins to test functional hypotheses

    • Development of biosensors based on Rpal_0309 if it has sensing/regulatory functions

  • Translational research:

    • Application of findings to enhance R. palustris for bioremediation

    • Development of improved plant growth-promoting inoculants

    • Exploration of biotechnological applications based on carbon substrate utilization

  • Evolutionary biology:

    • Comparative genomics across bacterial species to understand conservation

    • Analysis of selective pressures on the gene

    • Reconstruction of evolutionary history of the UPF0314 protein family

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.