Recombinant Rhodospirillum centenum ATP synthase subunit b' (atpG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
atpF2; atpG; RC1_3512; ATP synthase subunit b 2; ATP synthase F(0 sector subunit b 2; ATPase subunit I 2; F-type ATPase subunit b 2; F-ATPase subunit b 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-204
Protein Length
full length protein
Species
Rhodospirillum centenum (strain ATCC 51521 / SW)
Target Names
atpF2
Target Protein Sequence
MTQEVAPPAAAQDDAHGTAEHIAEGVAAETAEHAKGGLPQLNPDTYPTQIFWLAVTFGLL LFLMSKVALPRVAEVLEARQEKIADDLDRAGALKAEADAVIENYERELAEARAKAQKVLS DATLAAESETTQRLGELAADLAERARAAEARIEQARRAALGNIRGVAAETAVAAAAKLAG LDLDPATAEAAVEEALNRVRQEVV
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembrane catalytic core; and the F0 domain, containing the membrane proton channel. These domains are linked by a central and peripheral stalk. ATP synthesis in the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. The b' subunit is a divergent, duplicated form of the b subunit found in plants and photosynthetic bacteria; it forms part of the peripheral stalk, linking the F1 and F0 domains.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

How does Rhodospirillum centenum ATP synthase differ from other bacterial ATP synthases?

While the search results don't provide specific comparative data for R. centenum ATP synthase, several distinguishing features can be noted:

  • R. centenum is a photosynthetic bacterium that can undergo swim cell to swarm cell differentiation, which might influence the regulation and expression of its ATP synthase complex .

  • Unlike many other bacteria, photosynthetic species like R. centenum must coordinate their ATP synthesis machinery with photosynthetic electron transport, which may result in structural adaptations of the ATP synthase complex.

  • The atpG gene in R. centenum (synonymous with atpF2) is identified by the ordered locus name RC1_3512, which indicates its specific genomic context within this organism .

What are the optimal storage and handling conditions for recombinant R. centenum atpG protein?

Based on product specifications, the optimal storage and handling conditions for recombinant R. centenum atpG protein are:

ParameterRecommended Condition
Short-term storage4°C (up to one week)
Long-term storage-20°C
Extended storage-20°C or -80°C
Buffer compositionTris-based buffer with 50% glycerol, optimized for this protein
Freeze-thaw cyclesRepeated freezing and thawing is not recommended

Working aliquots should be prepared and stored at 4°C for up to one week to minimize protein degradation from repeated freeze-thaw cycles .

What experimental approaches are most effective for studying the role of atpG in energy coupling in R. centenum?

To effectively study atpG's role in energy coupling in R. centenum, several complementary approaches are recommended:

  • Site-directed mutagenesis: Introducing specific mutations in the atpG gene, particularly in the regions encoding transmembrane domains or interaction surfaces, can reveal functional relationships. Key residues to target would include the highly conserved regions that interact with other ATP synthase subunits.

  • Cross-linking studies: Chemical cross-linking combined with mass spectrometry can identify protein-protein interactions between atpG and other ATP synthase subunits, revealing the structural organization of the complex.

  • ATP synthesis/hydrolysis assays: Comparing wild-type and mutant forms of the protein using biochemical assays that measure ATP synthesis or hydrolysis rates under various conditions can quantify the functional impact of atpG modifications.

  • Single-molecule studies: Techniques such as FRET (Fluorescence Resonance Energy Transfer) can monitor conformational changes in the ATP synthase complex during catalysis, providing insights into how atpG contributes to the mechanical coupling.

  • Complementation studies: In vivo experiments in which mutant forms of atpG are expressed in atpG-deficient strains can demonstrate the functional significance of specific protein features.

These approaches should be selected based on the specific research question and available resources. Combining structural, biochemical, and genetic approaches provides the most comprehensive understanding of atpG function.

How does the structure-function relationship of atpG differ between swim and swarm cell types in R. centenum?

R. centenum undergoes differentiation between swim cells and swarm cells, which affects multiple cellular systems including motility mechanisms. While the search results don't provide direct data on atpG differences between these cell types, the following research approach would be appropriate:

  • Comparative proteomics: Isolate ATP synthase complexes from both swim and swarm cells to determine if there are post-translational modifications or expression level differences in atpG.

  • Bioenergetic profiling: Measure ATP synthesis rates and proton motive force utilization in both cell types to determine if energy coupling efficiency differs.

  • Membrane organization studies: Since R. centenum undergoes significant morphological changes during differentiation, membrane organization of ATP synthase complexes may differ between cell types. Super-resolution microscopy could reveal differential localization patterns.

The regulation of ATP synthase may be coordinated with the che-like signal transduction systems that control flagella biosynthesis in R. centenum, as these pathways are known to regulate cellular differentiation in response to environmental conditions .

What is the relationship between the atpG subunit and the che-like signal transduction pathways in R. centenum?

While direct evidence linking atpG to che-like signaling isn't provided in the search results, research into this relationship would likely reveal important insights into cellular energy regulation:

The che2 gene cluster in R. centenum is involved in controlling flagella biosynthesis, which is an energy-intensive process . Since ATP synthase is the primary ATP producer in the cell, there may be regulatory connections between these systems.

A potential experimental approach to investigate this relationship would include:

  • Genetic analysis: Creating double mutants with modifications in both atpG and che2 genes to identify possible synthetic phenotypes.

  • Metabolic profiling: Comparing ATP levels, NAD+/NADH ratios, and other energy metabolism markers in wild-type, atpG mutant, and che2 mutant strains.

  • Phosphoproteomics: Identifying changes in protein phosphorylation patterns affected by mutations in either system, which could reveal signaling connections.

  • Transcriptional analysis: Examining whether changes in atpG expression affect the transcription of che2 genes or vice versa.

Understanding this relationship would provide insights into how energy production is coordinated with motility in this bacterium.

How can recombinant atpG protein be effectively used in structural studies?

For structural studies of recombinant atpG protein, consider the following methodological approaches:

  • X-ray crystallography preparation:

    • Purify the protein to >95% homogeneity using affinity chromatography

    • Screen multiple buffer conditions to optimize protein stability

    • Use size exclusion chromatography to ensure monodispersity

    • For crystallization trials, start with 10-15 mg/ml protein concentration

  • Cryo-EM sample preparation:

    • For intact ATP synthase complexes containing atpG, stabilize with mild crosslinking agents

    • Apply 3-4 μl of sample (1-5 mg/ml) to glow-discharged grids

    • Vitrify samples using rapid freezing to preserve native structure

  • NMR spectroscopy:

    • For solution NMR studies, isotopic labeling (¹⁵N, ¹³C) is essential

    • For atpG, focus on soluble domains rather than membrane-spanning regions

    • Use 0.5-1.0 mM protein concentration in deuterated buffer systems

The recombinant atpG described in the search results is supplied at 50 μg per vial, which is sufficient for preliminary studies but would require scale-up for comprehensive structural analysis .

What are the best practices for designing experiments to study atpG interactions with other ATP synthase subunits?

To effectively study atpG interactions with other ATP synthase subunits:

  • Co-immunoprecipitation (Co-IP) protocol:

    • Generate antibodies specific to atpG or use the tag included in the recombinant protein

    • Use mild detergents (0.5-1% n-dodecyl β-D-maltoside) for membrane protein extraction

    • Perform Co-IP under varying salt concentrations (100-500 mM) to distinguish specific from non-specific interactions

    • Analyze precipitated complexes by Western blotting and mass spectrometry

  • Surface Plasmon Resonance (SPR) analysis:

    • Immobilize purified atpG on a sensor chip

    • Flow solutions containing potential interaction partners at concentrations of 1-1000 nM

    • Calculate kinetic parameters (kon, koff, KD) to quantify binding affinity

    • Compare wild-type interactions with those of site-directed mutants

  • Bacterial two-hybrid system:

    • Clone atpG and potential interaction partners into appropriate vectors

    • Transform into reporter strains and measure reporter gene expression

    • Include appropriate controls (known interactors and non-interactors)

    • Validate positive interactions with alternative methods

These approaches provide complementary data on protein-protein interactions and should be selected based on experimental objectives and available resources.

How can researchers effectively express and purify functional recombinant atpG for biochemical studies?

For optimal expression and purification of functional recombinant atpG:

  • Expression system selection:

    • For membrane proteins like atpG, consider specialized expression systems such as C41(DE3) or C43(DE3) E. coli strains

    • Alternative systems include cell-free expression for difficult membrane proteins

    • Expression temperature should be optimized (typically 16-30°C) to balance yield and folding

  • Purification strategy:

    • Two-step purification protocol:

      • Initial immobilized metal affinity chromatography (IMAC) using the provided tag

      • Secondary purification by ion exchange or size exclusion chromatography

    • Include appropriate detergents throughout purification (e.g., 0.05% DDM)

    • Monitor protein quality by SDS-PAGE and Western blotting at each step

  • Functional verification:

    • ATP synthase activity assays should be performed to ensure the purified protein retains functionality

    • Reconstitution into liposomes can restore native-like environment for functional studies

    • Circular dichroism spectroscopy can verify proper secondary structure formation

Purification StepBuffer CompositionCritical Parameters
Cell lysis50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1% DDM, protease inhibitorsComplete solubilization of membrane proteins
IMAC50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.05% DDM, 20-250 mM imidazole gradientSlow flow rate (0.5 ml/min)
Size exclusion50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.05% DDMSample concentration <5 mg/ml
StorageTris-based buffer with 50% glycerolAvoid repeated freeze-thaw cycles

The specific parameters may need adjustment based on protein behavior and experimental requirements .

How does understanding atpG function contribute to broader knowledge of bacterial bioenergetics?

Understanding atpG function in R. centenum provides valuable insights into bacterial bioenergetics for several reasons:

  • Evolutionary context: As a photosynthetic bacterium, R. centenum represents an important evolutionary link in the development of bioenergetic systems. Studying its ATP synthase components helps reconstruct the evolutionary history of energy-transducing membranes.

  • Adaptability mechanisms: R. centenum can thrive in diverse environments through differentiation between swim and swarm cells . Understanding how ATP synthase function might be modulated during this transition reveals mechanisms of bioenergetic adaptation.

  • Integration with signaling networks: The potential connection between ATP synthase and che-like signal transduction pathways suggests sophisticated regulatory networks that coordinate energy production with cellular behaviors such as motility .

  • Unique structural features: Any identified structural adaptations in R. centenum atpG could reveal novel mechanisms for coupling proton translocation to ATP synthesis in specialized bacterial environments.

This knowledge contributes to the fundamental understanding of how bacteria optimize energy production in response to environmental changes, which has implications for both basic science and biotechnological applications.

What are the most significant research challenges in studying R. centenum ATP synthase compared to other bacterial systems?

Research on R. centenum ATP synthase faces several unique challenges:

  • Complex differentiation phenotypes: R. centenum's ability to differentiate between swim and swarm cells introduces variables that must be controlled in experimental designs . Researchers must carefully define which cell type is being studied and ensure consistency in preparation methods.

  • Coordination with photosynthetic machinery: As a photosynthetic bacterium, R. centenum must coordinate ATP synthesis with light harvesting and electron transport chains, creating a more complex regulatory system to disentangle.

  • Limited genetic tools: Compared to model organisms like E. coli, genetic manipulation tools for R. centenum are less developed, making genetic studies more challenging.

  • Membrane protein challenges: The hydrophobic nature of ATP synthase components like atpG presents general technical difficulties in expression, purification, and structural studies. These challenges are magnified when working with less characterized organisms like R. centenum.

  • Integration with multiple signaling systems: Evidence suggests that R. centenum utilizes multiple che-like signal transduction pathways , creating a complex network that may influence ATP synthase function and regulation in ways difficult to isolate experimentally.

Addressing these challenges requires interdisciplinary approaches combining molecular biology, biochemistry, structural biology, and systems biology methodologies.

What emerging technologies could enhance research on R. centenum atpG and its role in bacterial physiology?

Several emerging technologies show particular promise for advancing R. centenum atpG research:

  • Cryo-electron tomography: This technique could reveal the native spatial organization of ATP synthase complexes within the bacterial membrane, providing insights into how atpG contributes to supramolecular assembly.

  • Single-cell metabolomics: By analyzing the metabolic profiles of individual R. centenum cells during differentiation, researchers could correlate ATP synthase activity with specific metabolic states.

  • CRISPR-Cas9 genome editing: Adapting CRISPR systems for R. centenum would enable precise genetic manipulations to study atpG function in vivo, including the creation of subtle mutations that affect specific protein interactions.

  • In-cell NMR spectroscopy: This approach could provide structural information about atpG in its native cellular environment, avoiding artifacts introduced by protein isolation and reconstitution.

  • Microfluidic cultivation systems: These systems would allow real-time observation of R. centenum differentiation while simultaneously measuring bioenergetic parameters, creating direct links between ATP synthase function and phenotypic changes.

Integrating these technologies would provide unprecedented insights into how atpG contributes to the bioenergetic flexibility that allows R. centenum to thrive in diverse environments.

How might comparative studies between R. centenum atpG and similar subunits in other bacterial species advance our understanding of ATP synthase evolution?

Comparative studies of atpG across bacterial species would provide valuable evolutionary insights:

  • Phylogenetic analysis framework:

    • Construct comprehensive phylogenetic trees using atpG sequences from diverse bacteria

    • Map structural and functional features onto these trees to identify conserved vs. variable regions

    • Correlate evolutionary patterns with ecological niches and metabolic strategies

  • Key research questions to address:

    • How have the membrane-spanning portions of atpG evolved in relation to different lipid environments?

    • Are interaction surfaces with other ATP synthase subunits more conserved than exposed surfaces?

    • Do photosynthetic bacteria show distinctive adaptations in atpG structure compared to non-photosynthetic species?

  • Experimental approaches:

    • Create chimeric proteins with atpG components from different species to identify functionally interchangeable domains

    • Use ancestral sequence reconstruction to test hypotheses about the adaptive trajectory of atpG evolution

    • Correlate sequence variations with differences in proton conductance or ATP synthesis efficiency

Such comparative approaches could reveal how ATP synthase has been fine-tuned through evolution to optimize energy conversion under diverse environmental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.