Recombinant Rhodospirillum centenum Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mtgA; RC1_3308; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-231
Protein Length
full length protein
Species
Rhodospirillum centenum (strain ATCC 51521 / SW)
Target Names
mtgA
Target Protein Sequence
MSMIPRLLRRMAAVLAGLALLLVALAVSYRWVPPPGSPLMAIRLAQGAPGIDRRWVPLDA ISPHLVAAVVASEDSRFCTHHGIDWDAVEAARDHNEAGGRLRGASTLSMQTAKNAFLWPD RTWLRKGAELGFTLLIEATWPKRRIAEVYLNLAEWGDGIFGAEAAARRHFGKPAADLSAQ EAALLAAVLPNPRRWSPERPTAYIRNRAATIERRMAIVRRDGLAACILDPA
Uniprot No.

Target Background

Function
A peptidoglycan polymerase that catalyzes glycan chain elongation from lipid-linked precursors.
Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Rhodospirillum centenum Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) and what is its function?

Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) from Rhodospirillum centenum is a glycan polymerase enzyme (EC 2.4.2.-) that catalyzes the polymerization of glycan strands during peptidoglycan biosynthesis. It plays a critical role in bacterial cell wall formation by joining the glycan components of peptidoglycan . The protein is involved in the transglycosylation step of cell wall synthesis, which is essential for maintaining bacterial cell integrity and shape.

Unlike bifunctional penicillin-binding proteins (PBPs) that possess both transglycosylase and transpeptidase activities, mtgA is monofunctional, focusing solely on glycan polymerization. The enzyme is particularly significant in understanding bacterial cell wall assembly mechanisms and potentially developing new antimicrobial strategies.

What are the optimal expression systems for recombinant R. centenum mtgA production?

Based on available research protocols, E. coli has been demonstrated as an effective expression system for recombinant R. centenum mtgA production . The protein can be expressed with an N-terminal His-tag to facilitate purification. When designing expression constructs, researchers should consider:

  • Codon optimization for E. coli if expression levels are suboptimal

  • Inclusion of the native signal sequence if membrane integration is desired

  • Expression temperature optimization (typically lower temperatures of 16-25°C may improve soluble protein yield)

  • Induction conditions optimization (IPTG concentration and induction duration)

For functional studies comparing full-length versus truncated versions (without TM domain), both constructs should be prepared, as research on related transglycosylases indicates that the TM segment significantly influences activity .

What purification methods and buffer conditions are recommended for recombinant mtgA?

For His-tagged recombinant R. centenum mtgA, a standard purification protocol should include:

  • Lysis buffer optimization: Tris-based buffers at pH 8.0 have been shown to be compatible with the protein

  • IMAC purification: Using Ni-NTA or similar metal affinity resins

  • Size exclusion chromatography: For further purification and buffer exchange

  • Storage buffer composition: Tris-based buffer with 50% glycerol has been documented as effective for long-term storage

The purified protein should be stored at -20°C/-80°C for extended storage, with aliquoting recommended to avoid repeated freeze-thaw cycles. Working aliquots can be maintained at 4°C for up to one week .

What methodologies can be employed to assess the transglycosylase activity of R. centenum mtgA?

Several complementary approaches can be used to assess mtgA transglycosylase activity:

  • Radiolabeled substrate incorporation assay: This technique monitors the incorporation of 14C-N-acetylglucosamine into trichloroacetic acid (TCA)-precipitable material. A modified procedure from that used with Aerococcus viridans membrane fractions can be adapted for R. centenum mtgA . The typical reaction contains:

    • 50 μg membrane fraction

    • 0.38 mM [14C]UDP-N-acetylglucosamine (specific activity ~4,000 cpm/nmol)

    • 0.33 mM UDP-N-acetylmuramylpentapeptide

    • 50 mM MgCl2

    • 0.21 mM KCl

    • 0.83 mM NH4Cl

    • 250 μg/ml penicillin G (to inhibit transpeptidase activity)

    • 50 mM Tris-HCl or PIPES buffer

  • Substrate mimics as inhibitor templates: Studies have shown that peptidoglycan glycosyltransferase substrate mimics can serve as templates for inhibitor design and can also be used in competitive binding assays to assess enzyme activity .

  • HPLC analysis of reaction products: For determination of glycan chain length and polymerization efficiency.

How does the transmembrane segment influence mtgA activity and what experimental approaches can address this question?

Research on related peptidoglycan glycosyltransferases indicates that the transmembrane (TM) segment plays a significant role in enzyme function. Studies comparing full-length proteins with their truncated counterparts (lacking the TM domain) have demonstrated that:

  • Full-length transglycosylases with TM segments generally show higher activity than truncated forms

  • The TM domain may influence substrate binding, moenomycin (an inhibitor) binding, and the glycosyltransferase reaction

  • In some cases, the TM segment affects the length of glycan chains produced

To experimentally evaluate the role of the TM segment in R. centenum mtgA, researchers should:

  • Create both full-length and truncated (TM-deleted) constructs

  • Compare enzymatic activity under identical conditions

  • Analyze glycan chain length distribution in products

  • Perform binding studies with substrates and inhibitors

Membrane reconstitution experiments with the purified protein in liposomes of defined composition may provide additional insights into how the membrane environment influences activity.

How does R. centenum mtgA compare with homologs from other bacterial species, particularly in terms of enzymatic properties?

While the search results don't provide direct comparative data for R. centenum mtgA versus other bacterial homologs, we can infer some points of comparison based on research on related transglycosylases:

  • Length comparison: R. centenum mtgA consists of 231 amino acids , which is close to the average MGT amino acid length of approximately 240 amino acids observed in other bacterial species .

  • Functional domains: Like other monofunctional transglycosylases, R. centenum mtgA likely contains a catalytic domain responsible for the glycosyltransferase activity and a transmembrane segment, which influences enzyme function as observed in related enzymes from other species .

  • Substrate specificity: Studies on transglycosylases from various species suggest some level of substrate conservation, typically utilizing UDP-N-acetylglucosamine and UDP-N-acetylmuramylpentapeptide as substrates .

To conduct a thorough comparative analysis, researchers should:

  • Perform sequence alignments with homologs from different bacterial species

  • Identify conserved catalytic residues and structural features

  • Compare kinetic parameters when assayed under identical conditions

  • Assess sensitivity to known transglycosylase inhibitors

What roles might mtgA play in antibiotic resistance mechanisms, particularly in the context of β-lactam resistance?

Though the search results don't specifically address R. centenum mtgA's role in antibiotic resistance, related research on lytic transglycosylases and β-lactam resistance provides valuable context:

  • In Azospirillum baldaniorum Sp245, a plant-growth-promoting rhizobacterium, an AmpC-type β-lactamase and a lytic transglycosylase (Ltg1) together mediate resistance to ampicillin . This suggests potential interaction between transglycosylases and β-lactam resistance mechanisms.

  • The expression of a lytic transglycosylase gene (ltg1) in A. baldaniorum is regulated by an extracytoplasmic function (ECF) σ factor (RpoE7), which plays a role in controlling ampicillin resistance .

  • Peptidoglycan biosynthesis enzymes like MGT play key roles in pathogenic gram-positive bacteria such as Staphylococcus aureus and Streptococcus pneumoniae .

To investigate potential roles of R. centenum mtgA in antibiotic resistance:

  • Evaluate expression levels in response to β-lactam exposure

  • Create knockout or overexpression strains and assess changes in antibiotic susceptibility

  • Test synergistic effects between β-lactams and transglycosylase inhibitors

  • Examine relationships between mtgA activity and cell wall stress responses

How can site-directed mutagenesis be used to identify critical functional residues in R. centenum mtgA?

Site-directed mutagenesis represents a powerful approach to dissect the structure-function relationships in R. centenum mtgA. Based on approaches used with related enzymes, the following strategy is recommended:

What experimental approaches could be used to investigate mtgA's role in Rhodospirillum centenum biology, particularly in relation to cyst formation?

Rhodospirillum centenum is known to form resting cyst cells when starved for nutrients . Given the importance of cell wall remodeling during developmental processes, investigating mtgA's role in this context could provide valuable insights:

  • Gene expression analysis:

    • RT-qPCR to measure mtgA expression during cyst formation

    • Promoter-reporter fusions (e.g., mtgA::lacZ) to monitor expression patterns

    • RNA-seq to place mtgA in the broader transcriptional network during development

  • Genetic manipulation approaches:

    • Construction of mtgA knockout mutants using mini-Tn5 transposon mutagenesis, similar to approaches used for other R. centenum genes

    • Controlled expression systems to modulate mtgA levels

    • Point mutations in chromosomal mtgA to alter activity while maintaining expression

  • Phenotypic characterization:

    • Microscopic examination of cell morphology and cyst formation

    • Cell wall composition analysis during different developmental stages

    • Antibiotic sensitivity testing throughout the developmental cycle

  • Interaction studies:

    • Identification of protein interaction partners during vegetative growth versus cyst formation

    • Analysis of potential regulatory proteins controlling mtgA expression or activity

    • Investigation of coordinated regulation with other cell wall enzymes

This approach would be particularly informative given that R. centenum is emerging as a genetically amenable model organism for molecular genetic analysis of cyst formation and cellular development .

How might R. centenum mtgA be utilized as a target for novel antimicrobial development?

Peptidoglycan biosynthesis enzymes represent attractive targets for antimicrobial development due to their essential role in cell wall assembly. For R. centenum mtgA specifically:

  • High-throughput screening approaches:

    • Development of fluorescence-based activity assays for compound library screening

    • Fragment-based drug discovery targeting the catalytic site

    • Virtual screening based on homology models or crystal structures

  • Structure-guided design:

    • Utilization of substrate mimics as templates for inhibitor design

    • Focus on compounds that interact with both the catalytic domain and transmembrane region

    • Development of bisubstrate analogs targeting the transglycosylation reaction

  • Natural product exploration:

    • Identification of natural product inhibitors of transglycosylases

    • Optimization of known inhibitors like moenomycin for improved properties

    • Combination strategies with β-lactams or other cell wall active agents

  • Evaluation metrics:

    • In vitro enzyme inhibition potency

    • Bacterial growth inhibition

    • Cell wall integrity assessment

    • Resistance development frequency

What methodological challenges exist in studying membrane-associated transglycosylases like mtgA, and how can they be addressed?

Membrane-associated proteins present unique experimental challenges:

  • Expression and purification obstacles:

    • Difficulty in obtaining sufficient quantities of properly folded protein

    • Potential toxicity when overexpressed

    • Need for detergents or membrane mimetics during purification

    Solutions: Utilize specialized expression strains, optimize induction conditions, explore fusion partners to enhance solubility, and consider cell-free expression systems.

  • Activity measurement challenges:

    • Dependence of activity on membrane environment

    • Difficulty in establishing physiologically relevant assay conditions

    • Potential for artifactual results with detergent-solubilized enzymes

    Solutions: Develop reconstitution protocols with defined lipid compositions, compare detergent-solubilized versus membrane-reconstituted activities, and utilize multiple complementary assay methods.

  • Structural characterization limitations:

    • Challenges in crystallizing membrane proteins

    • Difficulties in maintaining native conformation during analysis

    Solutions: Employ cryo-electron microscopy, NMR approaches optimized for membrane proteins, and computational modeling based on homologous structures.

  • In vivo functional assessment complexities:

    • Potential redundancy with other transglycosylases

    • Pleiotropic effects of manipulation

    Solutions: Create conditional mutants, employ chemical genetic approaches with specific inhibitors, and utilize synthetic genetic arrays to identify functional relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.