Recombinant Rhodospirillum centenum NADH-quinone oxidoreductase subunit K (nuoK)

Shipped with Ice Packs
In Stock

Description

Molecular and Functional Characteristics

NADH-quinone oxidoreductase subunit K (nuoK) is a 102-amino-acid protein encoded by the nuoK gene (UniProt ID: B6ISX1) in R. centenum. Key features include:

ParameterDetails
Molecular Weight~11.5 kDa (calculated from 1-102aa sequence)
StructureContains transmembrane helices; part of Complex I's membrane domain
Catalytic RoleFacilitates electron transfer to quinone and proton translocation
Expression SystemProduced in E. coli (full-length) or mammalian cells (partial)
Purity>90% (SDS-PAGE)
StorageLyophilized powder at -20°C/-80°C; reconstituted in Tris/PBS buffer

The amino acid sequence (MEIGLTHYLTVGAILFGLGAFGILMNRRNVIVLLMAIELMLLAVNINLVAFSVFLNDLTGQVFTLFILTVAAAEAAIGLAILVVYFRNRGTIAVEDINMMKG) is conserved across bacterial homologs .

Research Applications

Recombinant nuoK is pivotal for:

  • Enzymatic assays: Studying electron transfer kinetics and quinone reduction mechanisms .

  • Structural studies: Mapping transmembrane proton channels in Complex I .

  • Mutagenesis: Investigating residues critical for quinone binding (e.g., His144, Tyr145) .

  • Comparative physiology: Analyzing bacterial energy metabolism in R. centenum versus pathogens like E. coli or Campylobacter jejuni .

In R. centenum, nuoK supports phototrophic growth by maintaining redox balance during CO₂ fixation .

Phylogenetic and Functional Context

  • Evolutionary role: Complex I, including nuoK, is present in 52% of bacterial genomes but rare in archaea .

  • Physiological diversity: In R. capsulatus, nuoK drives reverse electron flow for NADH synthesis, whereas in E. coli, it supports anaerobic respiration .

  • Pathogenic relevance: Mutations in homologous subunits disrupt NADH oxidation in Salmonella enterica and Campylobacter, highlighting therapeutic potential .

Technical Notes

  • Activity assays: Use NADH/NADPH oxidation at 340 nm with quinones (e.g., ubiquinone-1) as substrates .

  • Inhibitors: Capsaicin-40 inhibits E. coli Complex I at IC₅₀ ~140 nM, a benchmark for studying nuoK .

  • Mutant studies: Suppressor mutations (e.g., nuoG Q297K) restore respiration in quinone-deficient strains .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
nuoK; RC1_1230; NADH-quinone oxidoreductase subunit K; NADH dehydrogenase I subunit K; NDH-1 subunit K
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-102
Protein Length
full length protein
Species
Rhodospirillum centenum (strain ATCC 51521 / SW)
Target Names
nuoK
Target Protein Sequence
MEIGLTHYLTVGAILFGLGAFGILMNRRNVIVLLMAIELMLLAVNINLVAFSVFLNDLTG QVFTLFILTVAAAEAAIGLAILVVYFRNRGTIAVEDINMMKG
Uniprot No.

Target Background

Function
NDH-1 facilitates the transfer of electrons from NADH, through FMN and iron-sulfur (Fe-S) centers, to quinones within the respiratory chain. In this species, the enzyme's immediate electron acceptor is believed to be ubiquinone. It couples the redox reaction with proton translocation (four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred), thus conserving the redox energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 4L family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is NADH-quinone oxidoreductase subunit K in Rhodospirillum centenum?

NADH-quinone oxidoreductase subunit K (nuoK) in Rhodospirillum centenum is a membrane protein component of the NADH dehydrogenase I complex (NDH-1). This protein functions as part of the electron transport chain essential for energy metabolism. The protein is encoded by the nuoK gene (ordered locus name: RC1_1230) and consists of 102 amino acids. It belongs to the enzymatic category EC 1.6.99.5 and forms a critical part of the bacterial respiratory machinery . The amino acid sequence begins with MEIGLTHYLTVGAILFGLGAFGILMNRRNVIVLLMAIE and continues through the complete 102-residue sequence that creates a transmembrane structure essential for the complex's function .

How does R. centenum nuoK differ structurally from homologous proteins in other bacterial species?

The nuoK protein in Rhodospirillum centenum shares structural homology with equivalent subunits in other purple photosynthetic bacteria but contains species-specific adaptations. Structural analysis reveals that R. centenum nuoK possesses characteristic transmembrane helices that facilitate its integration into the membrane-bound respiratory complex. When comparing the amino acid sequence with related species like Azospirillum brasilense, there are conserved regions essential for function while displaying unique variations that may contribute to the specific metabolic adaptations of R. centenum . These variations likely reflect evolutionary adaptations to R. centenum's distinctive photosynthetic capabilities and its ability to form dormant cysts under stress conditions .

What is the role of nuoK in the metabolic switching between photosynthetic and non-photosynthetic states in R. centenum?

The nuoK protein plays a crucial role in the metabolic flexibility of Rhodospirillum centenum, particularly during transitions between photosynthetic and non-photosynthetic growth modes. During photosynthetic growth, the NADH dehydrogenase complex containing nuoK operates in concert with the photosynthetic apparatus to maintain redox balance and energy production. During the shift to non-photosynthetic conditions or cyst formation, transcriptional analysis indicates significant remodeling of respiratory chain components . The nuoK subunit functions in modulating electron flow through the respiratory chain, adapting to changing environmental conditions. This regulation is coordinated with other metabolic changes, including alterations in ribosome biogenesis and translation machinery that occur during the transition to dormant cyst forms .

What are the optimal conditions for heterologous expression of recombinant R. centenum nuoK protein?

For optimal heterologous expression of recombinant R. centenum nuoK protein, a methodical approach involves selection of an appropriate expression system considering the membrane-bound nature of the protein. E. coli expression systems with specialized vectors containing strong, inducible promoters (T7 or tac) are recommended, with expression typically conducted at reduced temperatures (18-25°C) to facilitate proper membrane integration. The expression construct should include a fusion tag (His6, GST, or MBP) positioned to avoid disrupting transmembrane domains.

For membrane proteins like nuoK, expression protocols should include:

  • Induction at mid-log phase (OD600 ~0.6-0.8)

  • Extended expression periods (16-24 hours)

  • Supplementation with appropriate cofactors

  • Use of specific E. coli strains (C41(DE3) or C43(DE3)) engineered for membrane protein expression

Optimization of expression parameters, including media composition (often supplemented with glucose to prevent leaky expression), inducer concentration, and post-induction temperature, is crucial for maximizing functional protein yield while minimizing formation of inclusion bodies .

What purification strategy yields the highest activity for recombinant R. centenum nuoK?

Purification of recombinant R. centenum nuoK requires specialized approaches due to its hydrophobic nature and integration in the membrane. The most effective purification strategy employs a multi-step process:

  • Membrane Fraction Isolation: Cell lysis followed by differential centrifugation to isolate membrane fractions.

  • Detergent Solubilization: Careful selection of a detergent (typically DDM, LMNG, or digitonin) that maintains protein activity while effectively solubilizing the membrane.

  • Affinity Chromatography: Using immobilized metal affinity chromatography (IMAC) if a His-tag was incorporated, with specific buffer conditions optimized to maintain protein stability.

  • Ion Exchange Chromatography: Application of ion-exchange chromatography (typically anion exchange) to remove contaminants based on charge differences .

  • Size Exclusion Chromatography: Final polishing step to isolate properly folded, homogeneous protein.

Throughout the purification process, buffers should contain the selected detergent at concentrations above the critical micelle concentration, and often include glycerol (10-20%) to enhance stability. Activity assays should be performed after each purification step to ensure retention of functional protein . For optimal results, all purification steps should be performed at 4°C, and purified protein should be stored in Tris-based buffer with 50% glycerol at -20°C for short-term storage or -80°C for extended storage .

How can researchers overcome challenges in obtaining properly folded recombinant nuoK protein?

Obtaining properly folded recombinant nuoK protein presents significant challenges due to its multiple transmembrane domains. To overcome these challenges, researchers should implement:

  • Co-expression Strategies: Co-expressing nuoK with chaperone proteins (GroEL/GroES, DnaK/DnaJ) to assist proper folding.

  • Fusion Partner Selection: Using fusion partners known to enhance membrane protein solubility (e.g., MBP, SUMO) with careful design of linker regions.

  • Expression Environment Modification: Supplementing growth media with specific phospholipids or using E. coli strains with modified membrane compositions.

  • Nanodiscs or Lipid Reconstitution: Post-purification reconstitution into nanodiscs or liposomes to provide a native-like membrane environment.

  • Screening Multiple Detergents: Systematic evaluation of different detergents and detergent mixtures to identify optimal solubilization conditions.

Protein quality should be assessed through multiple analytical techniques including circular dichroism spectroscopy to evaluate secondary structure, fluorescence spectroscopy to assess tertiary folding, and functional assays to confirm enzymatic activity . Additionally, implementing limited proteolysis analysis can help identify properly folded regions versus misfolded segments of the protein.

What spectroscopic methods are most suitable for analyzing the redox properties of recombinant R. centenum nuoK?

For investigating the redox properties of recombinant R. centenum nuoK, several complementary spectroscopic techniques provide valuable insights:

  • UV-Visible Absorption Spectroscopy: Monitors changes in the absorption spectrum during oxidation/reduction, particularly useful for tracking the interaction with quinone substrates.

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: Essential for detecting and characterizing paramagnetic species formed during electron transfer, providing information about the electronic structure of redox centers.

  • Resonance Raman Spectroscopy: Offers detailed information about the vibrational modes of the protein's cofactors and how they change during redox reactions.

  • Protein Film Voltammetry: Enables direct electrochemical characterization by immobilizing the protein on an electrode surface and measuring electron transfer kinetics.

These techniques should be applied under controlled atmospheric conditions to prevent unintended oxidation. Data collection at various pH values and temperatures provides additional insights into the environmental factors affecting redox behavior. When analyzing results, researchers should account for the influence of detergent micelles or lipid environments on the protein's redox properties, as these can significantly alter the electronic environment of the redox centers .

How can researchers effectively measure electron transfer rates involving nuoK in reconstituted systems?

Measuring electron transfer rates involving nuoK in reconstituted systems requires sophisticated techniques that can capture the rapid kinetics of these reactions. The most effective approaches include:

  • Stopped-Flow Spectroscopy: Enables measurement of rapid reaction kinetics by monitoring absorbance changes following rapid mixing of the protein with electron donors/acceptors. This provides millisecond-to-second time resolution.

  • Proteoliposome Reconstitution: Reconstituting nuoK alone or with other complex I components into liposomes containing appropriate lipid compositions allows for measurement in a more native-like environment.

  • Artificial Membrane Systems: Using solid-supported bilayer lipid membranes with incorporated nuoK for electrochemical measurements.

  • Fluorescent Probes: Employing redox-sensitive fluorescent probes to monitor electron transfer events in real-time.

Data analysis should incorporate appropriate kinetic models, typically involving multi-exponential fitting to account for the multiple electron transfer steps. Researchers should systematically vary substrate concentrations, temperature, pH, and ionic strength to fully characterize the kinetic parameters. Control experiments using site-directed mutants can help identify specific residues involved in electron transfer pathways .

What are the most informative biochemical assays for evaluating interactions between nuoK and other subunits of the NADH dehydrogenase complex?

To evaluate interactions between nuoK and other subunits of the NADH dehydrogenase complex, several complementary biochemical approaches provide comprehensive insights:

  • Co-immunoprecipitation (Co-IP): Using antibodies against nuoK or other subunits to pull down the entire complex, followed by mass spectrometry or western blotting to identify interacting partners.

  • Cross-linking Coupled with Mass Spectrometry: Chemical cross-linking of the intact complex followed by proteolytic digestion and mass spectrometric analysis to identify contact points between subunits.

  • Surface Plasmon Resonance (SPR): Immobilizing nuoK on a sensor chip and flowing other purified subunits to measure binding kinetics and affinities.

  • Fluorescence Resonance Energy Transfer (FRET): Labeling nuoK and potential interacting partners with fluorophore pairs to detect proximity in reconstituted systems.

  • Bacterial Two-Hybrid Assays: Modified for membrane proteins to detect protein-protein interactions in vivo.

Data interpretation should account for the complex nature of membrane protein interactions, including the role of the lipid environment. Researchers should validate interactions using multiple techniques and consider the potential effects of detergents or lipid composition on observed interactions. Combining these biochemical approaches with structural methods like cryo-electron microscopy provides the most comprehensive understanding of subunit interactions .

How does R. centenum nuoK function differ during cyst formation compared to vegetative growth?

During the transition from vegetative growth to cyst formation in Rhodospirillum centenum, nuoK exhibits significant functional adaptations as part of broad metabolic remodeling. Transcriptome analysis reveals that genes involved in oxidative phosphorylation, including components of the NADH dehydrogenase complex, show altered expression patterns during encystment .

The metabolic shift observed during encystment includes alterations in membrane composition and exopolysaccharide production, which would directly impact the lipid environment in which nuoK functions. These changes may modify the efficiency of electron transfer through the NADH dehydrogenase complex, adapting energy production to the lower metabolic demands of the dormant cyst state .

What are the implications of nuoK mutations on bacterial photosynthesis and respiration in R. centenum?

Mutations in the nuoK gene can have profound implications for both photosynthetic and respiratory processes in Rhodospirillum centenum, revealing the interconnected nature of these energy-generating pathways. Genetic analysis suggests that alterations in nuoK can impact:

  • Electron Flow Regulation: Disruptions in nuoK can alter electron flow through the respiratory chain, affecting the redox balance necessary for efficient photosynthesis.

  • Photosynthetic Apparatus Assembly: Some mutations may have pleiotropic effects on the stability or assembly of the photosynthetic apparatus, similar to observations in carotenoid biosynthesis mutants .

  • Energy Coupling: Altered nuoK function can disrupt the proton-motive force generation, affecting ATP synthesis in both respiratory and photosynthetic conditions.

  • Metabolic Flexibility: Mutations may compromise the organism's ability to switch between photosynthetic and respiratory metabolism in response to environmental changes.

The specific phenotypes resulting from nuoK mutations would depend on the nature and location of the mutation within the protein structure. Complete loss-of-function mutations would likely have more severe consequences than missense mutations affecting specific functional domains. These findings highlight the integrated nature of photosynthetic and respiratory electron transport chains in R. centenum and the critical role of nuoK in maintaining proper electron flow through these systems .

How can multi-state design approaches be applied to engineer modified versions of nuoK for enhanced electron transfer properties?

Engineering modified versions of R. centenum nuoK with enhanced electron transfer properties can be approached using sophisticated multi-state design methodologies. The NUPACK multi-state design framework offers a particularly powerful approach by enabling simultaneous optimization across multiple functional states :

  • Multi-complex Ensemble Design: This approach would model nuoK in different conformational or association states, including:

    • Isolated nuoK protein state

    • nuoK integrated within the complete NADH dehydrogenase complex

    • nuoK interacting with quinone substrates

    • nuoK in alternative electron transfer pathways

  • Multi-tube Ensemble Optimization: For engineering nuoK variants with modified function, researchers should:

    • Create separate virtual "test tubes" that represent different environmental conditions (pH, redox potential, substrate concentrations)

    • Define target structures and concentrations for each state

    • Optimize sequences that simultaneously satisfy all design constraints

  • Implementation Strategy:

    • Identify key residues involved in electron transfer through comparative analysis

    • Apply computational design to modify these residues while maintaining structural stability

    • Introduce altered quinone binding sites or modified redox-active residues

    • Ensure compatibility with the protein's membrane environment

This approach captures concentration-dependent effects and potential crosstalk between components, which are critical for engineering electron transfer proteins . Engineered variants should be experimentally validated using the spectroscopic and biochemical methods described in section 3, with particular attention to electron transfer rates and substrate specificity.

How does the nuoK protein sequence and function in R. centenum compare with homologs in other photosynthetic bacteria?

The nuoK protein in Rhodospirillum centenum exhibits both conserved features and distinctive adaptations when compared to homologs in other photosynthetic bacteria. Comparative sequence analysis reveals:

OrganismSequence Identity (%)Key DifferencesFunctional Implications
Azospirillum brasilense~65-70%Variations in transmembrane domainsAdaptation to different membrane compositions
Rhodobacter sphaeroides~60-65%Modified quinone-binding residuesAltered substrate specificity
Rhodopseudomonas palustris~55-60%Changes in charged residuesDifferent proton translocation properties
E. coli (non-photosynthetic)~45-50%Substantial differences in loop regionsAdaptation to photosynthetic machinery integration

The functional differences correlate with each organism's specific ecological niche and metabolic capabilities. R. centenum's nuoK contains adaptations that facilitate its dual role in both respiratory and photosynthetic electron transport chains, with specific modifications that may enable the protein to function effectively during transitions between these metabolic modes . Additionally, the protein shows structural adaptations that potentially contribute to R. centenum's unique ability to form dormant cysts under stress conditions, suggesting evolutionary optimization for survival in fluctuating environmental conditions .

What insights do genomic and transcriptomic studies provide about the regulation of nuoK expression during developmental transitions?

Genomic and transcriptomic analyses offer valuable insights into the complex regulation of nuoK expression during developmental transitions in Rhodospirillum centenum. Key findings include:

  • Differential Expression Patterns: Transcriptome analysis reveals that nuoK, along with other components of oxidative phosphorylation machinery, shows significant changes in expression during the transition from vegetative cells to cysts .

  • Signaling Network Integration: The regulation of nuoK appears to be integrated with cyclic nucleotide signaling pathways involved in cyst development. The presence of cGMP and c-di-GMP signaling components in R. centenum suggests that these second messengers may influence nuoK expression as part of the global metabolic shift during encystment .

  • Coordinated Regulation: Expression changes in nuoK are coordinated with alterations in ribosome biogenesis, translation machinery, and amino acid metabolism, indicating that nuoK regulation is part of a comprehensive reprogramming of cellular physiology during developmental transitions .

  • Transcriptional Control Elements: Genomic analysis suggests the presence of conserved promoter elements upstream of the nuoK gene that may bind transcriptional regulators responsive to environmental signals, including oxygen concentration, light availability, and nutrient status .

These findings highlight that nuoK expression is dynamically regulated as part of a sophisticated response network that allows R. centenum to adapt to changing environmental conditions through developmental transitions .

How have advanced structural prediction methods contributed to understanding nuoK integration within the complete NADH dehydrogenase complex?

Advanced structural prediction methods have revolutionized our understanding of how nuoK integrates within the complete NADH dehydrogenase complex in Rhodospirillum centenum. These computational approaches have provided insights that would be challenging to obtain through traditional experimental methods alone:

  • AlphaFold2 and RoseTTAFold Applications: These AI-based structure prediction tools have enabled generation of high-confidence models of nuoK within the context of the entire NADH dehydrogenase complex, revealing critical interfacial contacts between subunits.

  • Molecular Dynamics Simulations: Long-timescale simulations of nuoK within membrane environments have elucidated dynamic aspects of protein function, including:

    • Conformational changes associated with electron transfer

    • Lipid-protein interactions that stabilize the complex

    • Water molecule dynamics in potential proton transfer pathways

  • Integrative Structural Modeling: Combining computational predictions with limited experimental data (cross-linking, EPR constraints) has generated comprehensive structural models of the entire complex, positioning nuoK within its functional context.

  • Multi-state Modeling Approaches: NUPACK and similar tools enable modeling of nuoK in different functional states, providing insights into the structural transitions that occur during the catalytic cycle .

These computational approaches have revealed that nuoK occupies a strategic position within the membrane domain of the complex, participating in both quinone binding and potentially in proton translocation pathways. The structural models suggest specific residues that may be involved in these functions, guiding experimental investigations through site-directed mutagenesis and functional assays .

What are the most promising approaches for studying nuoK function in the context of cellular bioenergetics?

The most promising approaches for studying nuoK function in cellular bioenergetics integrate cutting-edge technologies across multiple scales. At the molecular level, cryo-electron microscopy of the intact NADH dehydrogenase complex provides structural insights, while advanced spectroscopic methods capture electron transfer dynamics. Genetic approaches, including CRISPR-Cas9 genome editing to create precise mutations in nuoK, enable in vivo functional studies.

For comprehensive bioenergetic analysis, researchers should consider:

  • In vivo metabolic flux analysis using isotope labeling to track electron flow through different pathways

  • Live-cell imaging with fluorescent probes to monitor membrane potential and redox states in real-time

  • Systems biology approaches integrating transcriptomics, proteomics, and metabolomics data to place nuoK function in broader metabolic context

  • Microfluidic platforms for single-cell analysis of bioenergetic parameters under controlled environmental gradients

These integrated approaches will provide a more complete understanding of how nuoK contributes to cellular energy metabolism and how its function is modulated in response to environmental changes and developmental transitions .

How might engineered variants of nuoK contribute to biotechnological applications in bioenergy production?

Engineered variants of R. centenum nuoK could make significant contributions to biotechnological applications in bioenergy production through several innovative approaches:

  • Enhanced Electron Transfer Systems: Variants with optimized electron transfer properties could improve the efficiency of microbial fuel cells by facilitating electron transfer to electrodes.

  • Photobioelectrochemical Systems: Engineered nuoK proteins could create more efficient interfaces between photosynthetic electron transport chains and artificial electron acceptors, enhancing light-driven bioelectricity generation.

  • Metabolic Engineering Applications: Modified nuoK variants could redirect electron flow toward production of biofuels or high-value chemicals by altering the redox balance of cellular metabolism.

  • Biosensor Development: nuoK-based sensor systems could be developed to monitor environmental conditions relevant to bioenergy production, such as oxygen levels or redox potential.

Successful implementation of these applications would require multi-state design approaches as described in section 4.3, ensuring that engineered variants maintain stability while exhibiting the desired functional properties . The ability of R. centenum to form resistant cysts also presents opportunities for developing robust biocatalysts that can withstand variable conditions in industrial bioenergy production systems .

What critical questions remain unanswered regarding the structure-function relationship of nuoK in photosynthetic bacteria?

Despite significant advances in understanding nuoK, several critical questions remain unanswered regarding its structure-function relationship in photosynthetic bacteria:

  • Proton Translocation Mechanism: The specific amino acid residues and structural elements involved in potential proton translocation through nuoK remain poorly defined. How does the protein contribute to maintaining the proton gradient necessary for ATP synthesis?

  • Conformational Dynamics: The nature and magnitude of conformational changes in nuoK during the catalytic cycle are not fully characterized. How do these structural dynamics facilitate electron transfer and potential proton movement?

  • Quinone Interaction Specificity: The molecular basis for specific interactions with different quinone types in the membrane remains unclear. How does nuoK discriminate between various quinone species present in photosynthetic membranes?

  • Subunit Assembly Process: The sequence of events during assembly of nuoK into the complete NADH dehydrogenase complex is not well understood. What chaperones or assembly factors are involved in ensuring proper integration?

  • Regulatory Interactions: Potential post-translational modifications and protein-protein interactions that might regulate nuoK function under different environmental conditions remain to be elucidated.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.