Recombinant Rhodospirillum centenum Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
kdpC; RC1_0434; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-209
Protein Length
full length protein
Species
Rhodospirillum centenum (strain ATCC 51521 / SW)
Target Names
kdpC
Target Protein Sequence
MLTHLRPALTMILALTVLTGLAYPLAVTAVARLAFPEQAAGSLIHRADGTVLGSALIGQT FTRPEYFWSRPSAAGDGYDAANSSGTNLGPSNTALVAAVQARVEALKAANPDAVGPVPVD LVTASASGLDPHISPAAALWQAPRVAAARGLETGRVVELIRQATEGRVFGFLGEPSVNVL KLNLALDAQAPTPRQPEPGHPEPGRPEVR
Uniprot No.

Target Background

Function
This protein is part of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. Specifically, this subunit functions as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB by forming a transient KdpB/KdpC/ATP ternary complex.
Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the basic function of Potassium-transporting ATPase C chain (kdpC) in Rhodospirillum centenum?

The kdpC protein in R. centenum functions as part of the high-affinity potassium transport system (Kdp), serving as one subunit of the multi-component ATP-driven potassium pump. In this system, kdpC likely works in conjunction with kdpA (the channel-forming component) and kdpB (the catalytic ATPase subunit). This transport system plays a crucial role in maintaining potassium homeostasis particularly under potassium-limiting conditions. For R. centenum, which undergoes complex developmental processes including cyst formation, potassium transport likely plays a significant role in osmotic regulation necessary during transitions between vegetative and dormant states . R. centenum forms metabolically dormant cysts under unfavorable conditions such as desiccation or nutrient starvation, and proper ion balance would be critical during this morphological transformation .

What unique features distinguish kdpC in R. centenum from homologous proteins in other bacterial species?

While the search results don't provide specific structural information about R. centenum kdpC, general principles of evolutionary adaptation suggest several distinguishing features may exist. R. centenum occupies a specific ecological niche as part of the plant root rhizosphere and exhibits complex developmental processes including photosynthesis and cyst formation . These specialized functions likely exert selective pressure on all cellular systems, including potassium transport. The kdpC protein in R. centenum may contain unique structural adaptations that allow it to function optimally under shifting energy states, particularly during cyst formation when ATP levels drop significantly . Additionally, as R. centenum responds to environmental light cues and undergoes phototactic movement , its potassium transport systems might contain adaptations that integrate with these light-sensing pathways. Comparative sequence analysis with homologous proteins would reveal conserved domains and R. centenum-specific regions that could provide insights into these adaptations.

What are the optimal expression systems for producing recombinant R. centenum kdpC protein?

For functional studies requiring proper folding and assembly with other Kdp complex components, more specialized approaches may be necessary. These could include:

  • Coexpression with kdpA and kdpB to form a functional complex

  • Using specialized E. coli strains designed for membrane proteins

  • Employing lower induction temperatures (16-25°C) to enhance proper folding

  • Testing alternative host systems such as Rhodospirillum species themselves

The choice of tag location (N- or C-terminal) should be empirically determined, as improper tag placement can interfere with assembly into the Kdp complex . If expression in E. coli proves challenging, heterologous expression in purple photosynthetic bacteria could be considered, leveraging genetic systems already developed for R. centenum .

What purification challenges are specific to R. centenum kdpC and how can they be addressed?

Purification of R. centenum kdpC presents several challenges typical of membrane-associated proteins, but potentially complicated by the unique properties of this photosynthetic bacterium. The primary challenges include:

  • Membrane association: KdpC associates with membrane-spanning components of the Kdp complex, making solubilization a critical step. Use of appropriate detergents is essential - typically start with milder detergents such as n-dodecyl-β-D-maltoside (DDM) or digitonin before attempting stronger detergents like Triton X-100.

  • Maintaining stability: During purification, maintaining the native conformation requires careful buffer optimization. Consider including glycerol (10-20%), potassium ions, and potentially ATP analogs to stabilize the protein.

  • Complex integrity: If the goal is to purify the intact Kdp complex, more gentle solubilization conditions must be employed.

A methodological approach would involve:

  • Initial extraction with optimized detergent mixtures

  • Immobilized metal affinity chromatography (IMAC) if using His-tagged constructs

  • Size exclusion chromatography to separate properly folded protein from aggregates

  • Verification of functional integrity through ATPase activity assays

For challenging preparations, consider nanodisc technology or amphipol stabilization to maintain a more native-like environment for the protein . Optimization of these conditions would be specific to R. centenum kdpC and should be determined empirically.

How can isotope labeling of R. centenum kdpC be achieved for NMR studies?

Isotope labeling of R. centenum kdpC for NMR studies requires careful consideration of expression systems and labeling protocols to achieve sufficient incorporation while maintaining protein folding and stability. The recommended approach involves:

  • Expression system selection: E. coli BL21(DE3) strains remain the preferred choice, although specialized strains designed for membrane proteins might improve yields.

  • Minimal media formulation: For uniform 15N and 13C labeling, M9 minimal media supplemented with:

    • 15NH4Cl as the sole nitrogen source

    • 13C-glucose as the primary carbon source

    • Trace elements important for R. centenum metabolism

  • Expression optimization:

    • Lower temperatures (16-20°C) during induction

    • Extended expression times (18-24 hours)

    • IPTG concentration optimization (typically 0.1-0.4 mM)

  • Selective labeling strategies:

    • For complex proteins like kdpC, selective amino acid labeling may prove advantageous

    • Amino acid-specific labeling can reduce spectral complexity

  • Deuteration considerations:

    • Partial or complete deuteration may be necessary for larger constructs

    • Grown in D2O-based minimal media with deuterated carbon sources

  • Solubilization and purification:

    • Detergent selection is critical - deuterated detergents may be required

    • Consider nanodiscs or amphipols for maintaining native-like environment

The methodological approach must be empirically optimized specifically for R. centenum kdpC, as membrane proteins often require individualized protocols for successful isotope incorporation and maintenance of structural integrity .

What structural methods are most suitable for studying the R. centenum Kdp complex including the kdpC subunit?

Multiple structural biology approaches can be employed to characterize the R. centenum Kdp complex, each offering complementary information:

  • X-ray Crystallography:

    • Requires purification of a stable, homogeneous Kdp complex

    • Lipidic cubic phase (LCP) crystallization may be particularly suitable

    • Challenges include obtaining well-diffracting crystals and phase determination

    • Can provide high-resolution structures but may not capture conformational dynamics

  • Cryo-Electron Microscopy (Cryo-EM):

    • Increasingly powerful for membrane protein complexes

    • Requires less protein than crystallography

    • Can capture different conformational states

    • Sample preparation optimization with various detergents or nanodiscs is critical

  • Nuclear Magnetic Resonance (NMR) Spectroscopy:

    • Useful for studying dynamics and ligand interactions

    • May be limited to specific domains rather than the entire complex

    • Requires isotopic labeling as discussed in question 2.3

  • Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):

    • Provides information on solvent accessibility and conformational changes

    • Particularly valuable for studying the effects of ATP binding and potassium transport

  • Small-Angle X-ray Scattering (SAXS):

    • Can provide low-resolution envelope of the complex in solution

    • Useful for validating structural models from other methods

How does ATP binding affect the conformation and function of the R. centenum Kdp complex?

ATP binding likely induces significant conformational changes in the R. centenum Kdp complex that drive potassium transport through a coordinated mechanism. While specific details for R. centenum kdpC are not provided in the search results, general principles of P-type ATPases suggest the following mechanism:

  • Conformational Cycle:

    • ATP binding to the kdpB subunit (the catalytic component) triggers a conformational change

    • This change is transmitted to kdpC and kdpA subunits

    • The resulting structural rearrangement alters potassium binding affinity and accessibility

  • Energetic Coupling:

    • ATP hydrolysis energy is converted to mechanical movement

    • This drives potassium ions against their concentration gradient

    • The cycle involves phosphorylation-dephosphorylation steps typical of P-type ATPases

The ATP/ADP ratio in R. centenum is known to change dramatically during cyst formation, with significant reductions in ATP levels . This suggests that the Kdp complex activity may be regulated by cellular energy state, potentially participating in the physiological adaptations during dormancy. The complex might function differently under varying ATP concentrations, with potential regulatory mechanisms that respond to the energy status of the cell.

To experimentally examine these conformational changes, researchers could employ:

  • Site-directed spin labeling coupled with electron paramagnetic resonance (EPR)

  • Fluorescence resonance energy transfer (FRET) with strategically placed fluorophores

  • HDX-MS to map regions with altered solvent accessibility upon ATP binding

What functional assays can be used to assess potassium transport activity of recombinant R. centenum kdpC in reconstituted systems?

Several functional assays can be employed to assess the potassium transport activity of recombinant R. centenum kdpC when properly assembled with its partner proteins in reconstituted systems:

  • Liposome-based Potassium Flux Assays:

    • Reconstitute purified Kdp complex into liposomes

    • Use potassium-selective fluorescent dyes (e.g., PBFI) to monitor K+ movement

    • Alternatively, employ 86Rb+ as a radioactive tracer for potassium

    • Measure transport kinetics in response to ATP addition

  • Solid-Supported Membrane Electrophysiology:

    • Adsorb proteoliposomes containing the Kdp complex onto sensor chips

    • Measure transient currents upon ATP addition using rapid solution exchange

    • Quantify transport rates under various conditions

  • ATPase Activity Coupling Assays:

    • Monitor ATP hydrolysis using coupled enzyme assays (e.g., pyruvate kinase/lactate dehydrogenase system)

    • Correlate ATPase activity with potassium transport

    • Examine effects of potassium concentration, pH, and inhibitors

  • Patch-Clamp of Giant Liposomes:

    • Form giant unilamellar vesicles (GUVs) containing the Kdp complex

    • Apply patch-clamp techniques to measure single-channel properties

    • Determine conductance, open probability, and voltage dependence

  • Potentiometric Dyes in Whole-Cell Systems:

    • Express the R. centenum Kdp complex in a heterologous system lacking endogenous K+ transporters

    • Use membrane potential-sensitive dyes to monitor transport activity

    • Compare with known kdp mutants as controls

Experimental design should consider the unique properties of R. centenum, including its adaptation to varying energy states during cyst formation . Additionally, the potential regulatory role of cyclic nucleotides, particularly cGMP which is important in R. centenum development , should be investigated in relation to Kdp function. Control experiments using mutants similar to those created for studying photosynthesis in R. centenum could provide valuable insights into structure-function relationships .

How does the kdpC protein potentially interact with cyst formation pathways in R. centenum?

The kdpC protein, as part of the potassium transport system, may have significant interactions with cyst formation pathways in R. centenum through several potential mechanisms:

  • Energy State Sensing:

    • During cyst formation, R. centenum experiences a substantial decrease in ATP levels, measured as a change in adenylate charge (ATP/(ATP+ADP))

    • The Kdp system, being ATP-dependent, may serve as an energy state sensor

    • Changes in transport activity could signal energy limitation to developmental pathways

  • Osmotic Regulation:

    • Cyst formation involves significant morphological changes requiring osmotic adjustments

    • Controlled potassium influx/efflux through the Kdp system could regulate cell volume during encystment

    • Maintenance of appropriate ion gradients would be critical during cellular remodeling

  • Integration with Cyclic Nucleotide Signaling:

    • cGMP has been demonstrated to control R. centenum cyst development

    • Potential crosstalk between potassium homeostasis and cGMP signaling pathways may exist

    • The CRP homologue that binds cGMP could potentially regulate kdp expression

  • Developmental Checkpoint:

    • Proper ion balance may serve as a checkpoint for progression through developmental stages

    • Disruption of potassium transport could potentially affect timing or completion of cyst formation

To experimentally investigate these interactions, researchers could:

  • Generate kdpC deletion or point mutants and assess their cyst formation capabilities

  • Examine kdpC expression levels during different stages of encystment

  • Test for physical interactions between kdpC and known cyst formation regulators

  • Monitor intracellular potassium levels throughout the developmental process

This would build upon the established research on cyst formation mechanisms in R. centenum, including the roles of adenylate charge and cGMP signaling .

What methodologies can link kdpC function to photosynthetic capabilities in R. centenum?

Several methodological approaches can establish links between kdpC function and photosynthetic capabilities in R. centenum:

  • Genetic Correlation Studies:

    • Generate conditional kdpC mutants with varying levels of expression

    • Assess photosynthetic efficiency using oxygen evolution measurements

    • Analyze bacteriochlorophyll content and spectral properties in these mutants

    • Compare with the extensive library of photosynthesis mutants already characterized in R. centenum

  • Membrane Potential Analysis:

    • Potassium transport affects membrane potential, which in turn influences photosynthetic electron transport

    • Use membrane-potential sensitive dyes to correlate kdpC activity with photosynthetic membrane energization

    • Examine effects under different light conditions and potassium concentrations

  • Protein-Protein Interaction Studies:

    • Perform co-immunoprecipitation or crosslinking studies to identify potential physical interactions between kdpC and photosynthetic components

    • Use proximity labeling approaches (BioID, APEX) to map the protein neighborhood of kdpC

    • Validate interactions using fluorescence microscopy with appropriate tags

  • Integrated Physiological Measurements:

    • Simultaneously monitor potassium transport, ATP/ADP ratios, and photosynthetic electron transport

    • Establish temporal relationships between these processes under changing environmental conditions

    • Create a systems biology model integrating ion transport with energy generation

  • Subcellular Localization:

    • Determine if kdpC localizes near photosynthetic complexes using immunogold electron microscopy

    • Assess co-localization patterns under different growth conditions

This research would build upon the established genetic systems for R. centenum and could utilize similar approaches to those used in studying photosensory mutants . The goal would be to determine whether kdpC primarily serves housekeeping functions or plays a more specific role in coordinating photosynthetic activity with cellular ion homeostasis .

How can advanced microscopy techniques be applied to study the localization and dynamics of kdpC in living R. centenum cells?

Advanced microscopy techniques can provide crucial insights into the localization, dynamics, and function of kdpC in living R. centenum cells:

  • Fluorescent Protein Fusions:

    • Create chromosomal kdpC-fluorescent protein fusions (e.g., mNeonGreen, mScarlet)

    • Verify functionality through complementation of kdpC mutants

    • Use widefield or confocal microscopy to determine subcellular localization

    • Special consideration: ensure the fusion doesn't disrupt interaction with other Kdp complex components

  • Super-Resolution Microscopy:

    • Apply PALM/STORM techniques to achieve nanometer-scale resolution

    • Determine if kdpC forms clusters or associates with specific membrane domains

    • Compare localization patterns in vegetative cells versus developing cysts

    • Particularly valuable for examining potential co-localization with photosynthetic complexes

  • Single-Particle Tracking:

    • Use photoactivatable fluorescent proteins or quantum dots to track individual kdpC molecules

    • Analyze diffusion coefficients and confined motion patterns

    • Determine if mobility changes during cyst development or in response to light

  • FRET-Based Interaction Studies:

    • Create dual-labeled strains to examine interactions between kdpC and other proteins

    • Monitor FRET efficiency changes during developmental transitions

    • Particularly useful for studying interactions with cyst development regulators or photosynthetic components

  • Correlative Light and Electron Microscopy (CLEM):

    • Precisely locate fluorescently tagged kdpC then examine the same cells by electron microscopy

    • Particularly valuable for understanding localization during the complex morphological changes of cyst formation

These approaches would complement the genetic systems already established for R. centenum and could leverage the organism's phototactic capabilities to study dynamic responses to environmental stimuli. The light-responsive behavior of R. centenum makes it an excellent model for studying protein dynamics in response to controlled stimuli .

What are common pitfalls in generating kdpC mutants in R. centenum and how can they be overcome?

Generating functional kdpC mutants in R. centenum presents several challenges that researchers should anticipate and address methodically:

  • Essential Function Complications:

    • If kdpC is essential under standard laboratory conditions, complete deletion mutants may not be viable

    • Solution: Generate conditional mutants using inducible promoters or create point mutations affecting specific functions

    • Alternative: Use depletion approaches with degradation tags for temporal control

  • Genetic Redundancy Issues:

    • R. centenum may possess alternative potassium transport systems compensating for kdpC loss

    • Solution: Perform genomic analysis to identify all potential K+ transporters and consider generating multiple knockouts

    • Create growth conditions where the Kdp system is specifically required (low K+ media)

  • Homologous Recombination Efficiency:

    • R. centenum may have variable recombination efficiency at different genomic loci

    • Solution: Use mini-Tn5 transposon mutagenesis approaches previously successful in R. centenum

    • Optimize homology arm lengths specifically for the kdpC genomic region

  • Phenotypic Verification Challenges:

    • Mutant phenotypes may be subtle or condition-dependent

    • Solution: Develop specific assays for potassium transport function

    • Examine phenotypes under multiple conditions, including cyst induction and photosynthetic growth

  • Polar Effects on Gene Expression:

    • Mutations in kdpC may affect expression of neighboring genes in the kdp operon

    • Solution: Design non-polar deletion strategies or complement with the entire operon

    • Verify expression levels of adjacent genes in any mutant strains

  • Technical Approaches:

    • Leverage existing genetic systems for R. centenum including spectinomycin resistance markers

    • Consider CRISPR-Cas9 approaches adapted for R. centenum

    • Verify mutations with both PCR and sequencing to confirm precise genomic alterations

These troubleshooting approaches build upon established genetic manipulation techniques for R. centenum, particularly the mini-Tn5 transposon systems that have been successfully used to generate photosensory and photosynthesis mutants .

How can researchers resolve expression and solubility issues when working with recombinant R. centenum kdpC?

Resolving expression and solubility issues with recombinant R. centenum kdpC requires a systematic approach addressing the challenges specific to membrane-associated proteins:

  • Expression System Optimization:

    • Test multiple E. coli strains (BL21, C41/C43, Rosetta, SHuffle)

    • Consider specialized strains designed for membrane proteins

    • Explore expression in R. centenum itself or related purple photosynthetic bacteria

    • Try various promoter systems (T7, tac, araBAD) for different expression kinetics

  • Fusion Tag Strategies:

    • Screen multiple solubility-enhancing tags (MBP, SUMO, TrxA)

    • Test both N- and C-terminal tag placements to find optimal configuration

    • Consider dual tagging approaches for detection and purification

    • Include carefully designed linker sequences to minimize interference with folding

  • Expression Condition Optimization:

    ParameterVariations to Test
    Temperature16°C, 20°C, 25°C, 30°C
    Induction OD0.4, 0.6, 0.8, 1.0
    Inducer Concentration0.1, 0.25, 0.5, 1.0 mM IPTG
    Media CompositionLB, TB, 2xYT, Autoinduction
    Additives1% glucose, 500 mM sorbitol, 4% ethanol
    Duration4h, 8h, 16h, 24h
  • Membrane Protein-Specific Approaches:

    • Add specific lipids during expression (phosphatidylglycerol, cardiolipin)

    • Include osmolytes (glycine betaine, sucrose) to stabilize folding intermediates

    • Test expression with subunits of the Kdp complex for proper assembly

  • Extraction and Solubilization Optimization:

    • Screen detergent panel (DDM, LMNG, digitonin, GDN)

    • Test mixed micelle systems with cholesterol hemisuccinate

    • Consider native nanodiscs or styrene maleic acid copolymer (SMA) extraction

    • Optimize detergent:protein ratios and solubilization times

  • Stabilization Strategies:

    • Include ligands during purification (K+ ions, ATP/ADP)

    • Add specific lipids known to stabilize membrane proteins

    • Use stability screening approaches (SEC-based or thermal shift assays)

This systematic approach builds upon techniques that have been successful for other membrane proteins and incorporates specific considerations for R. centenum proteins, which may have adaptations related to the organism's unique photosynthetic and developmental capabilities .

What strategies can address data inconsistencies when studying R. centenum kdpC interactions with other cellular components?

When confronting data inconsistencies in studies of R. centenum kdpC interactions, researchers should implement a multi-faceted approach to identify sources of variability and establish reliable protocols:

  • Biological Variability Assessment:

    • Standardize growth conditions meticulously (light intensity, media composition, temperature)

    • Control for growth phase effects by harvesting at precise optical densities

    • Consider developmental state variability, especially given R. centenum's complex life cycle

    • Use single colony isolates and minimize passage number differences

  • Technical Approach Triangulation:

    • Employ multiple independent interaction detection methods:

      • Co-immunoprecipitation with antibodies targeting different epitopes

      • Proximity-based labeling (BioID, APEX)

      • In vivo crosslinking with various crosslinker chemistries

      • Split protein complementation assays (BiFC, split luciferase)

    • Confirm that all approaches converge on consistent interaction partners

  • Controls and Validation Framework:

    Type of ControlPurposeImplementation
    Positive InteractionEstablish assay functionalityKnown interacting partners (e.g., kdpB)
    Negative InteractionDetect non-specific bindingUnrelated membrane protein of similar topology
    Expression LevelNormalize for abundance effectsWestern blot quantification pre-experiment
    Cellular LocalizationVerify appropriate distributionMicroscopy verification pre-experiment
    Reciprocal PulldownConfirm bidirectional interactionTag swap between bait and prey
  • Quantitative Analysis Refinement:

    • Apply statistical methods appropriate for high variability datasets

    • Use SAINT or similar algorithms for probabilistic interaction scoring

    • Implement fold-enrichment thresholds calibrated with known controls

    • Consider Bayesian approaches to integrate multiple data types

  • Condition-Dependent Interaction Mapping:

    • Test interactions under various physiological states relevant to R. centenum:

      • Aerobic vs. photosynthetic growth conditions

      • Vegetative cells vs. developing cysts

      • Various light qualities (given R. centenum's phototaxis)

      • Different potassium concentrations

    • Establish interaction dynamics rather than binary outcomes

  • Interference from Experimental Manipulations:

    • Verify that tags or fusion proteins don't disrupt native interactions

    • Test multiple tag positions and types

    • Create untagged constructs for orthogonal validation

    • Use native mass spectrometry when possible to analyze intact complexes

This comprehensive approach acknowledges the complex biology of R. centenum, including its developmental processes and environmental responsiveness , while implementing rigorous controls to distinguish true interactions from technical artifacts.

How does the study of kdpC contribute to understanding evolutionary adaptations in R. centenum?

The study of kdpC provides a valuable lens through which to examine evolutionary adaptations in R. centenum, offering insights into how this bacterium has specialized for its ecological niche:

  • Adaptation to Fluctuating Potassium Environments:

    • Comparative analysis of the R. centenum Kdp system with those from other bacteria may reveal specializations for the rhizosphere environment

    • Sequence and structural adaptations might reflect the specific potassium fluctuations experienced in plant-associated habitats

    • Analysis of the kdp operon's regulatory elements could reveal unique control mechanisms evolved in R. centenum

  • Integration with Developmental Processes:

    • R. centenum forms metabolically dormant cysts under unfavorable conditions

    • Evolutionary modifications to kdpC may facilitate ion balance maintenance during dramatic cellular remodeling

    • Potential co-evolution with cyst formation pathways, particularly those involving cyclic nucleotide signaling

  • Coordination with Photosynthetic Machinery:

    • As a photosynthetic bacterium, R. centenum requires tight coordination between energy production and utilization

    • The Kdp system's ATP-consuming nature necessitates integration with photosynthetic electron transport

    • Unique adaptations may exist that link potassium transport to light-harvesting efficiency

  • Comparative Genomic Approaches:

    • Analysis of kdpC across the Rhodospirillaceae family and Azospirillum clade

    • Identification of R. centenum-specific sequence features through multiple sequence alignment

    • Detection of co-evolving residues that might indicate functional interactions specific to R. centenum

  • Horizontal Gene Transfer Assessment:

    • Examination of GC content and codon usage in the kdp operon

    • Phylogenetic analysis to detect potential horizontal acquisition events

    • Identification of mobile genetic elements associated with potassium transport genes

This evolutionary perspective connects kdpC function to the broader adaptive strategies of R. centenum, including its complex developmental processes and photosynthetic lifestyle , providing insights into how fundamental cellular processes have been modified throughout bacterial evolution.

What are the most effective experimental designs for studying kdpC function during different stages of the R. centenum life cycle?

Designing experiments to study kdpC function throughout the R. centenum life cycle requires careful consideration of the organism's unique developmental processes and appropriate methodologies for each stage:

  • Vegetative Growth Stage:

    Experimental ApproachSpecific MethodologyMeasured Parameters
    Controlled cultivationChemostat culture with defined K+ levelsGrowth rate, yield, morphology
    Transcriptional analysisRNA-seq with life cycle synchronizationkdpC expression patterns
    Fluorescent reporter fusionkdpC-promoter::GFP constructsTemporal expression dynamics
    Potassium transport assays86Rb+ uptake measurementsTransport kinetics, regulation
    Membrane potential monitoringVoltage-sensitive dyesElectrophysiological effects
  • Transition to Cyst Development:

    • Time-course experiments capturing the transition from vegetative growth to cyst formation

    • Correlation of kdpC activity with adenylate charge changes known to occur during this transition

    • Examination of potential cross-regulation between kdpC and cGMP signaling pathways

    • Microscopy tracking of kdpC-fluorescent protein fusions during morphological changes

  • Mature Cyst Stage:

    • Comparative proteomics of membrane fractions from vegetative cells versus mature cysts

    • Measurements of potassium content in dormant cysts versus vegetative cells

    • Assessment of kdpC contribution to desiccation and starvation resistance

    • Testing cyst revival kinetics in kdpC mutants versus wild-type

  • Integration with Environmental Sensing:

    • Connect kdpC function with R. centenum's phototactic responses

    • Test for light-regulated expression or activity of the Kdp system

    • Examine potassium transport during phototactic movement

    • Investigate potential crosstalk between photosensory and potassium sensing pathways

  • Genetic Tools and Approaches:

    • Utilize mini-Tn5 transposition mutagenesis successfully employed in R. centenum

    • Create conditional kdpC expression systems to manipulate levels at specific developmental stages

    • Implement Fluorescence Recovery After Photobleaching (FRAP) to study kdpC dynamics during transitions

    • Apply BioID proximity labeling to identify stage-specific interaction partners

These experimental designs build upon established methods for studying R. centenum biology, including its cyst formation processes and photosensory behaviors , while focusing specifically on understanding how kdpC function adapts to different physiological states throughout the lifecycle.

What computational approaches can predict functional relationships between kdpC and other signaling systems in R. centenum?

Advanced computational approaches offer powerful tools for predicting functional relationships between kdpC and other signaling systems in R. centenum:

  • Genome-Scale Network Reconstruction:

    • Construct a comprehensive metabolic and regulatory network model for R. centenum

    • Integrate transcriptomic data from different growth conditions and developmental stages

    • Apply flux balance analysis to predict how kdpC activity affects cellular physiology

    • Identify potential metabolic bottlenecks where potassium transport interfaces with other processes

  • Protein-Protein Interaction Predictions:

    • Apply coevolutionary analysis methods (Direct Coupling Analysis, GREMLIN) to detect co-evolving residues between kdpC and potential interaction partners

    • Use structure-based docking to predict physical interactions with other signaling proteins

    • Employ machine learning approaches trained on known bacterial interactomes

    • Generate testable hypotheses about direct interactions with cyst development regulators or photosensory components

  • Transcriptional Regulatory Network Analysis:

    • Identify conserved regulatory motifs in the kdp operon promoter region

    • Predict transcription factors that might coordinate kdpC expression with other cellular processes

    • Look for regulatory connections to the cGMP signaling pathway known to control cyst development

    • Examine potential regulatory links to photosynthesis gene expression

  • Signaling Pathway Cross-Talk Prediction:

    • Map known signaling systems in R. centenum (cGMP, photosensing, chemotaxis)

    • Apply Bayesian network analysis to infer conditional dependencies between pathways

    • Identify potential shared regulatory nodes where multiple pathways converge

    • Predict how potassium sensing might interface with other environmental sensing mechanisms

  • Dynamics Modeling Approaches:

    • Develop ordinary differential equation (ODE) models of potassium homeostasis

    • Integrate with existing models of bacterial development and signaling

    • Simulate system behavior under varying conditions

    • Generate predictions about system dynamics during transitions between growth states

These computational approaches would leverage the growing body of knowledge about R. centenum biology, including its complex developmental processes, photosynthetic capabilities, and unique signaling systems , while generating testable hypotheses about how kdpC functions within this integrated network.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.