Recombinant Rhodospirillum rubrum ATP synthase subunit a (atpB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for custom preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and additional fees are agreed upon in advance.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize development accordingly.
Synonyms
atpB; Rru_A3246; ATP synthase subunit a; ATP synthase F0 sector subunit a; F-ATPase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-241
Protein Length
full length protein
Species
Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)
Target Names
atpB
Target Protein Sequence
MHSPVEQFAIKPLVSIQVAGVDVSFTNSSLLMLLTVGLAAAFFWNATARRTLIPGRLQSA AEMLYEFVANMIRDNVGKEGMKYFPYILTLFVFVFLGNMLGMLPYSFTFTSHIAVTAALA VGIFIAVTIIGFARHGFHYFRMFFPHGAPLLTAPLLIPIELISYLSRPFSLSVRLFANMT VGHIMLKVLAGFVIMLGVVGGVVPFAVVLGVTVLEFFIAALQAYVFTILTCIYLNDAINM H
Uniprot No.

Target Background

Function
A key component of the proton channel, directly involved in proton translocation across the membrane.
Database Links
Protein Families
ATPase A chain family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the composition of Rhodospirillum rubrum ATP synthase and how does it differ from other bacterial ATP synthases?

Rhodospirillum rubrum ATP synthase belongs to the F-type ATP synthase family (F₀F₁) and consists of multiple subunits that form two main functional components: the membrane-embedded F₀ portion and the catalytic F₁ portion. The complex contains five subunits (α, β, γ, δ, and ε) in the F₁ portion, with the subunit β playing a critical role in ATP synthesis and hydrolysis . While the general architecture resembles other bacterial ATP synthases, R. rubrum ATP synthase has been particularly valuable for research because specific subunits can be selectively removed and reconstituted, allowing detailed functional studies. Notably, extraction experiments have demonstrated that both β and γ subunits are required for ATP synthesis and hydrolysis functions, with no evidence supporting different catalytic sites for these two activities in R. rubrum .

How does subunit a (atpB) contribute to the function of ATP synthase in R. rubrum?

Subunit a (atpB) is an integral membrane component of the F₀ portion that forms part of the proton channel. It works in conjunction with the c-ring to facilitate proton translocation across the membrane, which drives the rotary mechanism of ATP synthesis. While the search results don't specifically detail atpB function, research on other ATP synthase components reveals that the removal of β and γ subunits from R. rubrum chromatophores eliminates ATP-linked activities but preserves light-induced proton uptake and the formation of an electrochemical gradient . This suggests that while subunit a likely participates in the proton pathway, the catalytic function requires intact F₁ components. The generation of membrane potential (Δψ) and ion gradients drives ATP synthesis as demonstrated in reconstitution experiments with sodium ion gradients, which created driving forces of 90-150 mV sufficient for ATP production .

What are the optimal conditions for recombinant expression of R. rubrum ATP synthase subunits?

The expression of recombinant R. rubrum ATP synthase subunits presents significant challenges. Research has shown that the alpha subunit (RrF₁α) expresses only as insoluble inclusion bodies in unc operon-deleted Escherichia coli strains, regardless of growth condition modifications . For successful expression:

  • Use E. coli strains with deletions in the native ATP synthase genes to prevent interference

  • Optimize growth temperature, often lowering to 25-30°C may improve folding

  • Consider codon optimization for the R. rubrum sequence in E. coli

  • Test various induction protocols (IPTG concentration, induction timing, and duration)

Since expression typically results in inclusion bodies, subsequent refolding protocols become essential for obtaining functional protein .

What purification strategy yields the highest purity and activity for recombinant ATP synthase subunits?

A multi-step purification approach is recommended for ATP synthase subunits:

  • For inclusion body purification:

    • Thorough washing with detergent-containing buffers to remove contaminants

    • Solubilization using high concentrations of urea or guanidinium hydrochloride

  • For native purification from chromatophores:

    • Sequential extraction with specific salt concentrations (LiCl for β-subunit, LiBr for γ-subunit)

    • Ion exchange chromatography for further purification

    • Size exclusion chromatography to separate monomeric from aggregated forms

The sequential extraction method with lithium salts has proven particularly effective for R. rubrum, as it allows selective removal of subunits while maintaining membrane integrity, facilitating subsequent reconstitution experiments .

What are the critical factors for successful refolding of recombinant ATP synthase subunits?

The refolding of recombinant R. rubrum ATP synthase subunits requires careful optimization of several parameters:

  • Protein concentration: Lower concentrations of RrF₁α (approximately 50 μg/mL) significantly improve refolding efficiency by minimizing aggregation

  • MgATP requirement: High concentrations of MgATP (50 mM) are essential for effective refolding, with the efficiency saturating at approximately 60%

  • Monitoring approach: Functional refolding can be effectively monitored by assessing the refolded protein's ability to restore ATP synthesis and hydrolysis in β-less chromatophores

  • Size exclusion analysis: HPLC analysis of refolded RrF₁α typically shows a 50-60% decrease in aggregated forms and a parallel increase in monomeric peaks, indicating successful refolding

The refolding protocol results in significant conversion to monomeric forms for both α and β subunits, though β appears to refold more efficiently, appearing almost exclusively as a monomer under identical conditions .

How can functional activity be restored to ATP synthase-depleted chromatophores?

Restoring functional activity to depleted chromatophores involves:

  • For β-less chromatophores:

    • Addition of purified native or recombinant RrF₁β alone is insufficient for activity restoration

    • Combined addition of RrF₁α and RrF₁β is required to restore ATP synthesis and hydrolysis

  • For β,γ-less chromatophores:

    • Individual reconstitution with either β or γ alone does not restore ATP-linked activity

    • Simultaneous reconstitution with both β and γ subunits restores both ATP synthesis and hydrolysis to the same extent

  • Activity assessment:

    • ATP synthesis can be measured using a continuous luciferase assay

    • Activity is dependent on the presence of both subunits and proper assembly

The identical degree of restoration for both synthesis and hydrolysis activities indicates shared catalytic mechanisms for these functions in R. rubrum ATP synthase .

What methods are most effective for measuring ATP synthesis activity of reconstituted systems?

The most effective method for measuring ATP synthesis in reconstituted systems is a continuous luciferase assay that monitors the emitted light in real-time:

  • Assay setup:

    • Conducted at 37°C in white flat-bottomed 96-well microtiter plates

    • Proteoliposomes containing reconstituted ATP synthase are mixed with ATP Bioluminescence Assay Kit reagents

    • Baseline is recorded for 3 minutes before initiating ATP synthesis

  • Initiation and measurement:

    • ATP synthesis is typically initiated by adding 0.5 mM ADP and 2 μM valinomycin

    • Valinomycin induces a potassium diffusion potential (Δψ) by allowing K⁺ ions to enter the proteoliposome lumen

    • The resulting electrical field and ion gradients drive ATP synthesis

    • Measurements are performed in triplicates from independent experiments

  • Control experiments:

    • Include protonophores (e.g., TCS) or ionophores (e.g., ETH2120) to confirm gradient-dependent synthesis

    • Omit ADP to verify substrate specificity

    • Vary buffer compositions to test different driving forces

This method allows precise quantification of ATP synthesis rates and determination of the minimum driving force required for ATP production.

How can the driving forces for ATP synthesis be experimentally manipulated and measured?

Driving forces for ATP synthesis can be precisely controlled through buffer manipulation:

  • Generating defined membrane potentials (Δψ):

    • Create K⁺ gradients by using low K⁺ inside liposomes (0.5 mM) and varying external K⁺ (10-500 mM)

    • Add valinomycin to facilitate K⁺ diffusion, generating electrical potential

    • The magnitude of Δψ can be calculated from the K⁺ concentration ratio

  • Establishing ion gradients (ΔpNa or ΔpH):

    • For sodium gradients: Use high Na⁺ inside (205 mM) and vary external Na⁺ (1-15 mM)

    • The resulting ΔpNa creates an additional driving force that can be calculated

  • Combined driving forces (ΔμNa⁺ or ΔμH⁺):

    • Maintain constant Δψ (e.g., 60 mV) while varying ion gradients

    • This allows analysis of the total electrochemical driving force

  • Measurement verification:

    • Na⁺ or K⁺ concentrations should be determined with ion-specific electrodes

    • Control experiments with ionophores confirm the contribution of each gradient component

These methods have demonstrated that ATP synthesis can occur at physiologically relevant driving forces of 90-150 mV, contrary to expectations for enzymes with V-type motor subunits .

How do alpha-beta subunit interactions influence catalytic activity in R. rubrum ATP synthase?

The interaction between alpha and beta subunits is crucial for catalytic activity in R. rubrum ATP synthase, with several key findings:

  • Dimer formation and activity:

    • Incubation of RrF₁α and RrF₁β monomers, which individually lack ATPase activity, results in the parallel appearance of assembled α₁β₁-dimers and catalytic activity

    • No formation of α₃β₃-hexamers is observed, suggesting a unique assembly pattern for R. rubrum compared to other ATP synthases

  • Catalytic interface:

    • The α₁β₁-ATPase activity is comparable to native chloroplast CF₁-α₃β₃ activity, indicating that the R. rubrum dimers contain a fully functional catalytic nucleotide-binding site at their α/β interface

    • This suggests that the catalytic mechanism is preserved even in minimal subunit assemblies

  • Interface stability:

    • The inability to form α₃β₃-hexamers appears to reflect lower stability of the non-catalytic RrF₁ α/β interface

    • This distinctive feature may provide a unique model for studying fundamental aspects of the catalytic mechanism without the complexity of the full complex

These findings suggest that while the catalytic interface forms readily and functions efficiently, the structural stability required for higher-order assembly may depend on additional factors or subunits not present in the reconstituted system .

What is the relationship between proton translocation and ATP synthesis in the R. rubrum ATP synthase?

The relationship between proton translocation and ATP synthesis in R. rubrum ATP synthase reveals fundamental aspects of the chemiosmotic mechanism:

  • Subunit roles in proton pathway:

    • Removal of β and γ subunits eliminates ATP-linked activities but preserves light-induced proton uptake and gradient formation

    • This indicates that β and γ subunits are not integral parts of the H⁺ gate in the R. rubrum chromatophore membrane

    • The proton pathway likely involves primarily the F₀ components, including subunit a

  • Gradient components and ATP synthesis:

    • Light-induced proton uptake in β,γ-less chromatophores results in an electrochemical gradient consisting of both a pH gradient and membrane potential

    • Both components contribute to the driving force for ATP synthesis upon reconstitution

  • Minimum driving force requirements:

    • ATP synthesis has been demonstrated at driving forces of 90-150 mV, which represents the physiological range relevant for many organisms

    • This is particularly significant for understanding energy conversion near the thermodynamic limit of ATP synthesis

These findings highlight the modular nature of the ATP synthase complex, with distinct functional domains for proton translocation and ATP synthesis that must work together for energy conversion .

What are common challenges in expressing and purifying functional recombinant ATP synthase subunits?

Researchers frequently encounter several challenges when working with recombinant ATP synthase subunits:

Researchers should anticipate these challenges and plan for extensive optimization of refolding conditions, with particular attention to protein concentration and nucleotide requirements .

How can researchers distinguish between ATP synthesis and ATP hydrolysis activities in experimental systems?

Distinguishing between ATP synthesis and hydrolysis activities requires careful experimental design:

  • Directional control through buffer conditions:

    • ATP synthesis is promoted by establishing ion gradients (Na⁺ or H⁺) and membrane potential (Δψ)

    • ATP hydrolysis predominates when gradients are absent or when ATP is provided without ADP

  • Assay selection:

    • ATP synthesis is typically measured using luciferase assays that detect newly synthesized ATP

    • ATP hydrolysis can be measured through phosphate release assays or coupled enzyme systems

  • Control experiments:

    • Use of ionophores (valinomycin, ETH2120) and protonophores (TCS) to manipulate gradients

    • Omission of critical components (ADP for synthesis, ATP for hydrolysis) confirms specificity

  • Comparative analysis:

    • The relationship between synthesis and hydrolysis activities can provide insights into enzymatic function

    • In R. rubrum, removal and reconstitution of β and γ subunits affects both activities to the same extent, suggesting shared catalytic mechanisms

Careful implementation of these approaches allows researchers to characterize both the synthetic and hydrolytic functions of ATP synthase components under defined conditions .

How should researchers interpret differences in reconstitution efficiency between ATP synthase subunits?

Differences in reconstitution efficiency between ATP synthase subunits provide valuable insights into structural and functional relationships:

  • Subunit-specific folding properties:

    • RrF₁β refolding results in almost exclusively monomeric forms, while RrF₁α shows a mixture of monomeric and aggregated forms under identical conditions

    • These differences likely reflect intrinsic structural properties of each subunit

  • Functional implications:

    • The monomeric RrF₁α stimulates restoration of ATP synthesis and hydrolysis more efficiently than the refolded mixture containing aggregates

    • This indicates that proper folding to monomeric state is critical for functional reconstitution

  • Interface stability considerations:

    • The inability of properly refolded α and β monomers to form α₃β₃-hexamers, despite forming functional α₁β₁-dimers, suggests differential stability of catalytic versus non-catalytic interfaces

    • This provides insight into the assembly pathway and stability determinants of the complex

  • Evolutionary interpretations:

    • Differential reconstitution properties may reflect evolutionary adaptations specific to R. rubrum

    • These differences can inform comparative analyses across species and between F-type and V-type ATPases

When analyzing reconstitution data, researchers should consider these factors to properly interpret experimental outcomes and develop mechanistic hypotheses .

What statistical approaches are recommended for analyzing ATP synthesis activity data?

Rigorous statistical analysis is essential for interpreting ATP synthesis activity data:

  • Experimental replication:

    • Perform measurements in triplicates from at least three independent experiments

    • This enables assessment of both technical and biological variability

  • Time-course analysis:

    • ATP synthesis typically shows linear rates for initial periods (around 2 minutes)

    • Calculate synthesis rates from the linear portion of the curve to avoid underestimation due to gradient dissipation

  • Control normalization:

    • Express activity relative to appropriate controls (e.g., no ionophore, complete reconstitution)

    • This facilitates comparison across different experimental conditions

  • Statistical testing:

    • Apply appropriate parametric or non-parametric tests based on data distribution

    • Include error bars representing standard deviation or standard error of the mean in data tables and figures

  • Relationship analysis:

    • When studying driving force relationships, consider regression analysis to determine threshold values

    • Plot synthesis rates against driving force parameters (Δψ, ΔpNa, ΔμNa⁺) to identify minimum requirements

Following these approaches enables robust quantitative analysis of ATP synthesis data and facilitates comparison with results from other systems .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.