Recombinant Rhodospirillum rubrum ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
atpF1; Rru_A3243; ATP synthase subunit b 1; ATP synthase F(0 sector subunit b 1; ATPase subunit I 1; F-type ATPase subunit b 1; F-ATPase subunit b 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-182
Protein Length
full length protein
Species
Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)
Target Names
atpF1
Target Protein Sequence
MISLALAAETAEHGGEAASHGGLFADPAFWVSIAFLMVVGFVYIKAKNKILGALDGRGAA VKAKLDEARKLRDDAQALLAEYQRRQRDAMKEADEIIRHAKDEAARLRAKAEADLEASIR RREQQAVDRIAQAEAQALAQVRNEAVDVAVSAARSLMAGSLAKADQNRLIDAAIADLPGK LH
Uniprot No.

Target Background

Function

F1F0 ATP synthase synthesizes ATP from ADP using a proton or sodium gradient. This enzyme comprises two domains: the F1 domain, containing the extramembranous catalytic core, and the F0 domain, containing the membrane proton channel. These domains are connected by a central and peripheral stalk. ATP synthesis within the F1 catalytic domain is coupled to proton translocation via a rotary mechanism involving the central stalk subunits. This protein is a component of the F0 channel and forms part of the peripheral stalk, linking F1 to F0.

Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the genomic organization of ATP synthase genes in Rhodospirillum rubrum?

Rhodospirillum rubrum contains a unique organization of ATP synthase genes divided into two separate operons. The first operon encodes the five subunits of the extrinsic membrane sector (F1-ATPase). The second operon, named atp2, contains a cluster of structural genes encoding the membrane subunits of the F0 sector, including subunit b (atpF) .

The complete nucleotide sequence analysis of this region (4240 bp) reveals that the order of genes in R. rubrum is a-c-b'-b, where b and b' are homologues. This organization differs from that found in E. coli and suggests that the ATP synthase complex in R. rubrum contains nine different polypeptides rather than the eight found in E. coli .

How does the Rhodospirillum rubrum ATP synthase subunit b differ from other bacterial homologues?

The R. rubrum b subunit undergoes post-translational modification during or before assembly into the ATP synthase complex. N-terminal sequencing of the protein has demonstrated that the first seven amino acid residues are removed during this process . This post-translational processing is a distinguishing feature of the R. rubrum ATP synthase complex.

Additionally, unlike other bacterial species that have only one type of b subunit, R. rubrum possesses two distinct but homologous b subunits (b and b'). This structural arrangement is similar to that found in certain cyanobacteria (Synechococcus 6301 and Synechococcus 6716) and likely reflects the closer evolutionary relationship between photosynthetic bacteria and chloroplasts .

What experimental approaches are recommended for expressing recombinant R. rubrum atpF?

For successful expression of recombinant R. rubrum atpF, researchers should consider the following methodological approach:

  • Vector selection: Use expression vectors with strong, inducible promoters (such as T7 or tac) for controlled expression.

  • Host system: E. coli strains BL21(DE3) or C43(DE3) are recommended for membrane protein expression as they are designed to handle potentially toxic membrane proteins.

  • Codon optimization: Consider codon optimization for E. coli expression, as R. rubrum may have different codon usage patterns.

  • Fusion tags: Incorporate affinity tags (His6, FLAG, or Strep-tag) to facilitate purification, preferably at the C-terminus to avoid interference with post-translational processing of the N-terminus.

  • Expression conditions: Optimize temperature (typically 18-25°C for membrane proteins), inducer concentration, and induction duration to maximize correctly folded protein yield.

This methodology is derived from general approaches for expressing membrane proteins and specific considerations for ATP synthase components documented in comparative studies .

How do experimental designs differ when studying driving forces for ATP synthesis in R. rubrum compared to other bacterial species?

The experimental design for studying driving forces in R. rubrum ATP synthase requires careful consideration of both electrical field (Δψ) and ion gradient (ΔpH) components. Unlike some ATP synthases that can use either component alone, the R. rubrum enzyme requires a combination of both driving forces for ATP synthesis .

A methodological approach for measuring ATP synthesis driven by these forces includes:

  • Proteoliposome preparation: Reconstitute purified ATP synthase into liposomes with controlled internal and external ion compositions.

  • Generating artificial driving forces:

    • Create Δψ using potassium diffusion potential with valinomycin

    • Establish ΔpH by pH gradient across the membrane

    • Measure combined effects by manipulating both parameters simultaneously

  • Quantification of ATP synthesis: Use luciferin-luciferase assay for real-time measurement of ATP production.

  • Control experiments: Include ionophores (e.g., TCS, ETH2120) to collapse specific gradients and verify coupling.

Comparative analysis shows that R. rubrum ATP synthase behaves similarly to enzymes from Wolinella succinogenes and chloroplasts from spinach, requiring both driving forces for ATP synthesis, unlike certain other bacterial ATP synthases that can utilize a single component .

ATP Synthase SourceCan Use Δψ AloneCan Use ΔpH/ΔpNa AloneThreshold Value for ATP Synthesis
Escherichia coliNoNo150 mV
Propionigenium modestumNoNo120 mV
Acetobacterium woodiiYesNo90 mV
Rhodospirillum rubrumNoNoRequires combination of forces

Table 1: Comparison of driving force requirements across bacterial ATP synthases

What are the methodological challenges in analyzing post-translational modifications of R. rubrum atpF?

Analyzing the post-translational modifications of R. rubrum ATP synthase subunit b presents several methodological challenges that require sophisticated approaches:

  • N-terminal processing verification:

    • Use Edman degradation sequencing of purified native and recombinant proteins

    • Apply mass spectrometry (MS/MS) to identify precise cleavage sites

    • Develop antibodies specific to both processed and unprocessed forms for western blot analysis

  • Protease identification:

    • Design experiments with protease inhibitors to identify the responsible enzyme

    • Create site-directed mutants at the cleavage site to analyze processing efficiency

    • Perform in vitro processing assays with cellular extracts

  • Functional significance assessment:

    • Compare ATP synthesis efficiency between wild-type and processing-deficient mutants

    • Analyze assembly kinetics using pulse-chase labeling and co-immunoprecipitation

    • Assess structural integrity using cross-linking studies and cryo-electron microscopy

  • Temporal sequence determination:

    • Distinguish whether processing occurs before or during complex assembly

    • Use time-course experiments with synchronized expression systems

    • Apply fluorescence resonance energy transfer (FRET) to monitor real-time assembly

When expressing recombinant atpF, researchers must consider whether the expression system contains the necessary machinery for appropriate post-translational processing, as this may impact protein functionality and structural integrity .

How can researchers design experiments to investigate the evolutionary relationship between R. rubrum ATP synthase genes and chloroplast ATP synthase?

To investigate the evolutionary relationship between R. rubrum ATP synthase and chloroplast ATP synthase, researchers should employ a multi-disciplinary experimental approach:

  • Phylogenetic analysis:

    • Construct comprehensive phylogenetic trees using multiple sequence alignments of ATP synthase subunits

    • Include sequences from diverse bacterial species, archaea, chloroplasts, and mitochondria

    • Apply maximum likelihood, Bayesian inference, and neighbor-joining methods to validate tree topology

    • Calculate evolutionary distances and divergence times

  • Comparative genomics:

    • Analyze gene arrangement patterns across photosynthetic bacteria, cyanobacteria, and chloroplasts

    • Examine synteny and gene cluster organization

    • Identify conserved regulatory elements in promoter regions

  • Functional complementation studies:

    • Express chloroplast ATP synthase subunits in R. rubrum deletion mutants

    • Assess restoration of function through growth and ATP synthesis measurements

    • Compare kinetic parameters between hybrid and native complexes

  • Structural biology approaches:

    • Use cryo-EM to determine high-resolution structures of both complexes

    • Perform detailed structural comparisons of subunit interfaces and critical functional domains

    • Identify conserved and divergent structural elements

The search results indicate that the gene arrangement for F0 subunits in R. rubrum (a-c-b'-b) is similar to that found in cyanobacteria (Synechococcus 6301 and Synechococcus 6716), supporting the endosymbiotic origin of chloroplasts. This suggests that ATP synthase complexes in photosynthetic bacteria contain nine different polypeptides rather than eight found in E. coli enzymes, with chloroplast ATP synthase likely resembling the photosynthetic bacterial enzymes in this respect .

What experimental design principles should be applied when measuring ATP synthesis activity of recombinant R. rubrum ATP synthase?

When designing experiments to measure ATP synthesis activity of recombinant R. rubrum ATP synthase, researchers should follow these methodological principles:

  • Reconstitution system optimization:

    • Use liposomes with controlled lipid composition (typically a mixture of phosphatidylcholine and phosphatidic acid)

    • Achieve optimal protein-to-lipid ratio for maximum activity (typically 1:50 to 1:100 w/w)

    • Verify incorporation efficiency using sucrose gradient centrifugation

  • Driving force establishment:

    • Generate defined membrane potential using K+ diffusion with valinomycin

    • Create precise pH gradients using buffer systems with strong buffering capacity

    • Measure and confirm the magnitude of established gradients using fluorescent probes

  • Activity measurement protocol:

    • Use luciferin-luciferase assay for real-time ATP detection

    • Include appropriate controls to verify ATP synthesis is coupled to the proton gradient

    • Perform measurements at physiologically relevant temperature (optimal for R. rubrum)

  • Critical controls:

    • Include uncouplers (e.g., FCCP, TCS) to confirm coupling between gradient and ATP synthesis

    • Use ATPase inhibitors (e.g., DCCD, oligomycin) as specificity controls

    • Include ADP-free conditions to verify ATP detection is not from contaminating kinases

  • Data analysis considerations:

    • Calculate initial rates from linear portions of progress curves

    • Determine threshold potential required for ATP synthesis

    • Compare kinetic parameters (Km, Vmax) with native enzyme preparations

R. rubrum ATP synthase, like those from Wolinella succinogenes and chloroplasts, requires a combination of both electrical potential (Δψ) and pH gradient (ΔpH) components for ATP synthesis, unlike some other bacterial ATP synthases that can utilize a single component .

How can researchers address data inconsistencies when comparing native and recombinant R. rubrum ATP synthase activities?

When confronted with discrepancies between native and recombinant R. rubrum ATP synthase activities, researchers should implement the following systematic troubleshooting approach:

  • Expression system evaluation:

    • Verify correct post-translational processing of the b subunit (removal of seven N-terminal residues)

    • Confirm complete assembly of all nine subunits using SDS-PAGE and western blotting

    • Assess lipid composition differences between native and expression system membranes

  • Purification protocol assessment:

    • Compare detergent effects on protein stability and activity

    • Evaluate potential loss of essential lipids or cofactors during purification

    • Implement activity measurements at multiple purification stages

  • Reconstitution method optimization:

    • Test different reconstitution methods (detergent dialysis, direct incorporation, rapid dilution)

    • Optimize protein orientation in liposomes (right-side-out vs. inside-out)

    • Verify proteoliposome size distribution and homogeneity

  • Measurement condition standardization:

    • Ensure identical buffer composition, pH, and ionic strength

    • Standardize temperature, substrate concentrations, and measurement durations

    • Use internal standards to normalize between different preparations

  • Systematic data analysis:

    • Apply statistical tests appropriate for paired comparisons

    • Isolate variables that correlate with activity differences

    • Consider multiple activity parameters (ATP synthesis rate, P/O ratio, coupling efficiency)

A methodological decision tree can guide the systematic identification and resolution of inconsistencies:

  • First, verify protein integrity (correct sequence, folding, assembly)

  • Then assess functional coupling (response to inhibitors, ion specificity)

  • Finally compare kinetic parameters under standardized conditions

This approach helps distinguish genuine functional differences from artifacts of expression and reconstitution .

What experimental approaches can elucidate the interaction between subunit b and other components of the R. rubrum ATP synthase complex?

To investigate interactions between subunit b and other components of the R. rubrum ATP synthase complex, researchers can employ these methodological approaches:

  • Cross-linking studies:

    • Use homo- and hetero-bifunctional cross-linkers with various spacer lengths

    • Apply UV-activatable or cleavable cross-linkers for reversible linkage

    • Identify cross-linked partners by mass spectrometry after protease digestion

    • Map interaction interfaces by combining with site-directed mutagenesis

  • Co-immunoprecipitation and pull-down assays:

    • Develop antibodies specific to different domains of subunit b

    • Use tagged recombinant proteins for affinity purification

    • Analyze co-precipitated proteins by western blotting and mass spectrometry

    • Compare interactions under different energetic states

  • Förster resonance energy transfer (FRET) analysis:

    • Create fusion proteins with appropriate fluorophore pairs

    • Measure energy transfer efficiency to determine relative distances

    • Perform time-resolved FRET to detect dynamic interactions

    • Map interaction domains through systematic fluorophore positioning

  • Cryo-electron microscopy:

    • Determine high-resolution structures of the intact complex

    • Generate 3D reconstructions of subcomplexes lacking specific components

    • Identify subunit b density through difference mapping

    • Validate interactions through focused refinement of interface regions

  • Functional mutagenesis studies:

    • Create targeted mutations at predicted interaction sites

    • Assess effects on complex assembly, stability, and activity

    • Design complementation experiments with mixed mutant subunits

    • Correlate structural perturbations with functional consequences

These approaches should account for the unique feature of R. rubrum ATP synthase containing two distinct b subunits (b and b'), which differs from E. coli but resembles the arrangement in cyanobacteria and chloroplasts .

How should researchers design comparative studies between ATP synthases from R. rubrum and other bacterial species?

When designing comparative studies between R. rubrum ATP synthase and other bacterial species, researchers should implement a systematic approach that addresses both structural and functional aspects:

  • Selection of comparative species:

    • Include representatives from diverse bacterial phyla

    • Select organisms with different energetic requirements

    • Include both closely related (photosynthetic bacteria) and distant (non-photosynthetic) species

    • Consider evolutionary relationships to chloroplasts and mitochondria

  • Standardized expression and purification:

    • Use identical expression systems for all recombinant proteins

    • Apply consistent purification protocols to minimize method-dependent variations

    • Verify equivalent purity and integrity across all samples

    • Quantify protein concentration using multiple complementary methods

  • Structural comparison methodology:

    • Employ consistent structural determination techniques (cryo-EM, X-ray crystallography)

    • Analyze subunit stoichiometry using quantitative mass spectrometry

    • Compare protein-protein interaction networks through cross-linking studies

    • Examine post-translational modifications across species

  • Functional comparative parameters:

    • Measure ATP synthesis and hydrolysis rates under identical conditions

    • Determine threshold potentials required for ATP synthesis

    • Assess coupling efficiency between proton translocation and ATP synthesis

    • Compare ion specificity (H+ vs Na+) and regulatory mechanisms

ParameterR. rubrumE. coliP. modestumA. woodiiMethod of Measurement
Ion SpecificityH+H+Na+Na+Ion-dependent activity assays
Required Driving ForcesΔψ + ΔpHΔψ + ΔpHΔψ + ΔpNaΔψ or ΔpNaArtificial gradient reconstitution
Subunit Composition9 subunits8 subunits8 subunits10 subunitsSDS-PAGE and mass spectrometry
Gene OrganizationTwo separate operonsSingle operonSingle operonSingle operonGenome sequence analysis

Table 2: Comparative parameters across bacterial ATP synthases for experimental design

This systematic approach allows for meaningful comparisons that can reveal how structural differences correlate with functional properties, evolutionary adaptations, and ecological niches across species .

What biophysical methods are most appropriate for studying the conformational dynamics of R. rubrum ATP synthase subunit b?

Studying the conformational dynamics of R. rubrum ATP synthase subunit b requires sophisticated biophysical approaches that can capture structural changes under physiologically relevant conditions:

  • Single-molecule FRET (smFRET):

    • Label specific residues with donor-acceptor fluorophore pairs

    • Monitor real-time distance changes between labeled positions

    • Track conformational distributions and transitions during catalysis

    • Correlate conformational states with functional steps

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS):

    • Map solvent accessibility changes in different functional states

    • Identify regions with altered dynamics during catalytic cycle

    • Compare flexibility between free and complex-incorporated subunit b

    • Detect subtle structural impacts of post-translational processing

  • Site-directed spin labeling electron paramagnetic resonance (SDSL-EPR):

    • Introduce spin labels at strategic positions

    • Measure interspin distances and mobility parameters

    • Determine orientation and environmental constraints

    • Detect conformational heterogeneity in different functional states

  • Nuclear magnetic resonance (NMR) spectroscopy:

    • Assign chemical shifts for backbone and side chain atoms

    • Monitor chemical shift perturbations during protein-protein interactions

    • Perform relaxation measurements to characterize dynamics on multiple timescales

    • Apply residual dipolar couplings to determine relative domain orientations

  • Time-resolved cryo-electron microscopy:

    • Capture transitional states using rapid mixing and freezing

    • Generate 3D reconstructions of multiple conformational states

    • Quantify population distributions under different conditions

    • Create molecular movies of conformational transitions

These methods should be applied in the context of the unique structural features of R. rubrum ATP synthase, particularly the presence of two distinct b subunits (b and b') and the post-translational modification involving removal of seven N-terminal amino acids .

How can researchers design experiments to investigate the impact of post-translational modifications on R. rubrum atpF function?

To investigate the impact of post-translational modifications (PTMs) on R. rubrum atpF function, researchers should implement a comprehensive experimental strategy:

  • Site-directed mutagenesis approach:

    • Create variants that prevent the N-terminal processing (modify cleavage site)

    • Design mutants that mimic permanently processed state (delete first seven residues)

    • Introduce mutations at potential phosphorylation or other modification sites

    • Generate chimeric constructs swapping modification regions with other species

  • Functional characterization methodology:

    • Compare ATP synthesis and hydrolysis activities between modified and unmodified forms

    • Measure proton translocation efficiency using pH-sensitive fluorescent dyes

    • Assess complex assembly kinetics with and without proper processing

    • Determine thermal and chemical stability profiles of different variants

  • Structural impact assessment:

    • Perform comparative structural analysis using cryo-EM or X-ray crystallography

    • Apply limited proteolysis to detect conformational differences

    • Use fluorescence spectroscopy to monitor local environmental changes

    • Employ molecular dynamics simulations to predict structural consequences

  • Interaction network analysis:

    • Compare protein-protein interaction profiles using pull-down assays

    • Identify differential binding partners through affinity purification-mass spectrometry

    • Measure binding affinities and kinetics using surface plasmon resonance

    • Map changes in interaction interfaces using hydrogen-deuterium exchange

  • In vivo significance evaluation:

    • Develop expression systems that allow controlled modification

    • Create R. rubrum strains with mutations affecting modification sites

    • Assess growth phenotypes under different energetic conditions

    • Measure ATP synthesis efficiency in native membrane vesicles

Experimental design should specifically address the N-terminal processing of the b subunit, where the first seven amino acid residues are removed during or before assembly of the ATP synthase complex. This modification may play critical roles in proper assembly, stability, or function of the complex .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.