Recombinant Rhodospirillum rubrum Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA)

Shipped with Ice Packs
In Stock

Description

Introduction

Rhodospirillum rubrum is a purple, non-sulfur bacterium capable of fixing nitrogen and utilizing syngas as a carbon and energy source . It possesses a unique cell curvature, which is established by asymmetric peptidoglycan remodeling . Peptidoglycan (PG) is a crucial component of the bacterial cell wall, protecting the cell from internal turgor pressure . Monofunctional transglycosylases, including MtgA, are enzymes involved in peptidoglycan synthesis, catalyzing the formation of glycan strands .

Peptidoglycan and its Synthesis

Peptidoglycan is essential for nearly all bacteria, providing a protective mesh-like structure around the cytoplasmic membrane . PG synthases, also known as penicillin-binding proteins (PBPs), have transpeptidase and glycosyltransferase activities . The glycosyltransferase activity polymerizes lipid II to form glycan strands .

Role of PapS in R. rubrum Cell Curvature

In R. rubrum, cell curvature is achieved through asymmetric peptidoglycan remodeling . The protein PapS is a key morphogenetic factor in R. rubrum, facilitating elongasome entrapment at the outer curve of the cell . Deletion of papS results in straight sacculi, which suggests PapS's role in the spatiotemporal control of peptidoglycan biosynthesis .

PapS Phylogenetic Distribution

PapS homologs are widespread in Alphaproteobacteria, particularly in the Rhodospirillales order, which indicates that the curvature-inducing activity of PapS is conserved in various bacteria .

Visualizing Peptidoglycan Biosynthesis

Peptidoglycan biosynthesis can be directly visualized using fluorescent D-alanine analogs like HADA, which label newly incorporated cell wall material .

Regulation of Peptidoglycan Synthesis

The regulation of peptidoglycan synthesis is crucial for bacterial growth and cell division . Uncontrolled hydrolase activity, resulting from the inhibition of peptidoglycan synthesis, can lead to cell lysis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
mtgA; Rru_A0027; Biosynthetic peptidoglycan transglycosylase; Glycan polymerase; Peptidoglycan glycosyltransferase MtgA; PGT
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)
Target Names
mtgA
Target Protein Sequence
MRTMDGRWRWGRLVLLGLFIVFLGWPLSLLMVFRVAPVPATPLMVLRLLEGEGLAKDWVP LEAIAPALRRAVIASEDGRFCQHGGFDTKELEKAWSDYQRGDRLRGASTLSMQTAKNLML WDGRNWLRKGLEAYDTVLLEALWPKRRILEVYLNIVEWGPGIYGAEAAARHHFGVSAAAL SPRQAALLAVVLPNPREWSAGRPGAYVSRRAATIQARMGAVDLGKDGACG
Uniprot No.

Target Background

Function
A peptidoglycan polymerase catalyzing glycan chain elongation from lipid-linked precursors.
Database Links
Protein Families
Glycosyltransferase 51 family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the biological function of mtgA in Rhodospirillum rubrum?

Monofunctional biosynthetic peptidoglycan transglycosylase (mtgA) in R. rubrum catalyzes glycan chain elongation of peptidoglycan, the major component of bacterial cell walls. Unlike bifunctional penicillin-binding proteins (PBPs), mtgA specifically catalyzes the transglycosylation reaction, forming β-1,4-glycosidic bonds between N-acetylmuramic acid (MurNAc) and N-acetylglucosamine (GlcNAc) residues. In the context of R. rubrum, a photosynthetic nitrogen-fixing bacterium, mtgA likely plays an essential role in maintaining cell wall integrity under varying environmental conditions, including transitions between aerobic and anaerobic growth states .

Functionally, mtgA polymerizes lipid II precursors to form the glycan backbone of peptidoglycan. Based on studies in E. coli, mtgA localizes at the division site and interacts with multiple divisome proteins, suggesting its involvement in septal peptidoglycan synthesis during cell division .

How does mtgA differ from other peptidoglycan glycosyltransferases?

mtgA differs from other peptidoglycan glycosyltransferases in several key aspects:

FeaturemtgABifunctional PBPs
Functional domainsMonofunctional (TG only)Bifunctional (TG + TP)
Catalyzed reactionOnly transglycosylationBoth transglycosylation and transpeptidation
Penicillin sensitivityInsensitive to penicillinSensitive to penicillin (TP domain)
LocalizationPrimarily at division siteThroughout cell envelope and division site
Interaction partnersSpecific divisome components (PBP3, FtsW, FtsN)Various cell wall synthesis proteins
Cell division roleSecondary, specialized functionPrimary peptidoglycan synthesis

In E. coli, single PBP1c or mtgA mutants and a double mutant do not show obvious phenotype changes but demonstrate a 5- to 10-fold increase in tetra-pentamuropeptide levels, indicating their involvement in specific peptidoglycan modification processes rather than bulk synthesis .

What are the active site characteristics of mtgA?

Based on structural and functional studies of related glycosyltransferases (particularly S. aureus MGT), the active site of R. rubrum mtgA likely contains several key features :

  • Donor site residues:

    • Basic residues (likely K140 and R148 equivalents) that stabilize the pyrophosphate leaving group of lipid II

    • Binding pocket for the growing glycan chain

  • Acceptor site residues:

    • A catalytic glutamic acid residue (likely equivalent to E100) that acts as a general base for the 4-OH of GlcNAc to facilitate the transglycosylation reaction

    • Binding pocket for the incoming lipid II molecule

  • Inhibitor binding site:

    • Overlaps with the donor site

    • Binding site for moenomycin, the only known natural product that directly inhibits transglycosylases

The catalytic mechanism likely involves the deprotonation of the 4-OH group of GlcNAc by the glutamic acid residue, enabling nucleophilic attack on the C1 carbon of MurNAc to form the β-1,4-glycosidic bond, with concomitant release of the pyrophosphate leaving group .

What are optimal expression systems for recombinant R. rubrum mtgA?

Optimizing expression of recombinant R. rubrum mtgA requires careful consideration of multiple factors. Based on established protocols for similar membrane-associated enzymes, the following approach is recommended:

Host Selection and Construct Design

For full-length mtgA (including the TM domain):

  • E. coli strains specialized for membrane protein expression (C41/C43 or Lemo21)

  • Cell-free expression systems as mentioned in commercial offerings

  • Inclusion of an affinity tag (His-tag) for purification

  • Consider multiple construct designs with variation in tag position and linker length

For soluble domain constructs (without TM domain):

  • Standard E. coli expression strains (BL21(DE3), Rosetta)

  • Bacillus subtilis for potential secreted expression

  • Fusion partners that enhance solubility

Expression Optimization

Codon optimization strategies as demonstrated for other recombinant proteins in B. subtilis can significantly increase expression levels. In one study with microbial transglutaminase, codon optimization resulted in 67.5% higher protein production . For R. rubrum mtgA, the following parameters should be optimized:

ParameterRecommended ConditionsRationale
Temperature16-25°CLower temperatures improve membrane protein folding
Induction0.1-0.5 mM IPTGModerate induction prevents aggregation
Growth mediaTB or MOPS minimalRich media for biomass, minimal for control
AdditivesGlycerol 5-10%Stabilizes membrane proteins
Harvest timeOD600 = 1.0-1.5Balance between yield and quality

Purification Strategy

For successful purification of active mtgA:

  • Membrane extraction with mild detergents (DDM, LDAO)

  • IMAC purification via His-tag

  • Size exclusion chromatography for oligomeric state assessment

  • Storage in buffer containing 50% glycerol at -20°C

This approach has yielded functional recombinant proteins with ≥85% purity as determined by SDS-PAGE .

How can researchers measure mtgA enzymatic activity in vitro?

Establishing reliable assays for mtgA activity is crucial for functional characterization. Based on methodologies used for related enzymes, the following approaches are recommended:

Substrate Preparation

Natural lipid II is complex and expensive; researchers can use:

  • Commercially available fluorescently labeled lipid II analogs

  • Synthesized simplified substrate mimics as described for S. aureus MGT

  • Radiolabeled substrates for high sensitivity detection

Activity Assays

Several complementary methods should be employed:

  • Direct polymerization assay:

    • Incubate purified mtgA with lipid II in appropriate buffer

    • Monitor glycan chain formation by SDS-PAGE or HPLC

    • Quantify product formation by densitometry or fluorescence

  • Coupled enzymatic assay:

    • Detect pyrophosphate release using coupling enzymes

    • Real-time monitoring via spectrophotometric methods

Assay Validation Controls

  • Positive control: Known active glycosyltransferase (e.g., E. coli PBP1b)

  • Negative control: Heat-inactivated enzyme

  • Inhibition control: Moenomycin (specific TG inhibitor)

  • Specificity control: Modified substrates missing key recognition elements

How does R. rubrum's complex metabolism influence mtgA function?

R. rubrum's remarkable metabolic versatility presents a unique context for studying mtgA function. This bacterium can grow under diverse conditions including photosynthetic, respiratory, and nitrogen-fixing modes, each with distinct metabolic requirements .

Metabolic Interface with Cell Wall Synthesis

Research should investigate how mtgA activity correlates with:

  • Carbon metabolism:

    • During photoheterotrophic growth on various carbon sources

    • Under CO-dependent growth conditions as described in hydrogen production studies

    • During transitions between autotrophic and heterotrophic metabolism

  • Energy metabolism:

    • ATP availability from different metabolic modes

    • Membrane potential effects on cell wall precursor transport

  • Sulfur metabolism:

    • Potential connections with the methionine salvage pathway

    • MTA-dependent growth conditions as described in studies of RubisCO function

    • Coordination with RubisCO and RLP function under aerobic vs. anaerobic conditions

Experimental Design for Metabolic Studies

To investigate these interfaces, researchers should design experiments that:

  • Compare mtgA expression and activity across growth conditions:

    • Photosynthetic (light) vs. non-photosynthetic (dark) growth

    • Aerobic vs. anaerobic conditions

    • Various carbon and nitrogen sources

  • Analyze cell wall composition changes:

    • Peptidoglycan structure analysis by HPLC

    • Cross-linking patterns under different growth conditions

    • Incorporation of labeled precursors into cell wall

  • Examine mtgA regulation in response to metabolic shifts:

    • Transcriptional profiling during transitions

    • Post-translational modifications under different conditions

    • Protein-protein interactions with metabolic sensors

The UVa-ALE (UV-accelerated adaptive laboratory evolution) approach used to study R. rubrum adaptation to CO in darkness provides a valuable methodology that could be adapted to investigate mtgA function under metabolic stress conditions.

Predicted Interaction Network

To investigate these interactions in R. rubrum, researchers should:

  • Identify R. rubrum homologs of key divisome components through bioinformatic analysis

  • Examine potential interactions using bacterial two-hybrid systems

  • Verify localization patterns using fluorescent protein fusions

  • Assess dependency relationships through epistasis analysis

Experimental Evidence from E. coli Model

Studies in E. coli provide a framework for investigating mtgA interactions in R. rubrum. Bacterial two-hybrid experiments showed that mtgA interacts specifically with PBP3, FtsW, and FtsN, with interaction strengths comparable to established interactions like PBP1b-PBP3 . The interaction with PBP3 requires its transmembrane segment.

Interestingly, mtgA also interacts with itself, suggesting potential oligomerization that could be functionally significant . This self-interaction could be investigated in R. rubrum using similar methodologies.

Functional Significance Testing

To determine the functional significance of these interactions in R. rubrum, researchers should:

  • Create conditional depletion strains for key divisome components

  • Examine effects on mtgA localization and activity

  • Test whether mtgA overexpression can compensate for deficiencies in other components

  • Investigate coordination between transglycosylase and transpeptidase activities

How can researchers address methodological challenges in studying mtgA function?

Studying mtgA function presents several methodological challenges that require careful experimental design:

Genetic Manipulation Strategies

  • Gene deletion approach:

    • Create clean deletion mutants using homologous recombination

    • Complement with wild-type and mutated versions

    • Create conditional expression systems for essential functions

  • Addressing potential redundancy:

    • Construct multiple mutants lacking several transglycosylases

    • Develop systems for controlled depletion of multiple enzymes

    • Use chemical genetics with specific transglycosylase inhibitors

Membrane Protein Biochemistry

The membrane-bound nature of mtgA presents specific challenges for biochemical studies:

  • Solubilization approaches:

    • Optimize detergent selection for extraction from membranes

    • Consider nanodiscs or amphipols for maintaining native environment

    • Compare properties of full-length vs. truncated constructs

  • Activity preservation:

    • Develop reconstitution systems in proteoliposomes

    • Optimize buffer conditions to maintain structure and function

    • Consider the influence of lipid composition on activity

In Vivo Analysis

To connect biochemical characterization with physiological function:

  • Develop assays for in vivo transglycosylase activity:

    • Fluorescent D-amino acid incorporation

    • Cell wall metabolic labeling

    • Peptidoglycan structural analysis

  • Phenotypic characterization under stress conditions:

    • Antibiotic susceptibility profiles

    • Osmotic stress tolerance

    • Growth across environmental transitions

  • Real-time imaging approaches:

    • Fluorescent protein fusions for localization studies

    • FRET-based interaction monitoring

    • Correlative light-electron microscopy for structural context

These methodological approaches will help overcome the challenges inherent in studying a membrane-bound enzyme in a metabolically complex organism like R. rubrum.

What are the potential applications of studying R. rubrum mtgA in antibiotic research?

Transglycosylases represent an underexploited target for antibiotic development. While transpeptidases are targeted by β-lactams (penicillins, cephalosporins), few antibiotics target the transglycosylation reaction .

mtgA as an Antibiotic Target

R. rubrum mtgA research could contribute to antibiotic development in several ways:

  • Structure-based drug design:

    • Using structural information to develop specific inhibitors

    • Targeting unique features of bacterial transglycosylases

    • Developing molecules that exploit the lipid II binding pocket

  • Natural product screening:

    • Identifying novel inhibitors beyond moenomycin

    • Screening for compounds active against resistant strains

    • Testing specificity against different bacterial transglycosylases

  • Resistance mechanisms:

    • Understanding how bacteria develop resistance to transglycosylase inhibitors

    • Identifying potential compensatory mechanisms

    • Developing combination strategies to prevent resistance

Conserved Active Site Features

The lipid II-contacting residues in transglycosylases are highly conserved in both wild-type and drug-resistant bacteria . This conservation suggests that resistance to transglycosylase inhibitors might develop more slowly than to other antibiotics, making them attractive targets for development.

Key mechanistic insights from S. aureus MGT studies suggest that:

  • K140 and R148 in the donor site stabilize the pyrophosphate-leaving group of lipid II

  • E100 in the acceptor site acts as a general base for the 4-OH of GlcNAc

These mechanistic details, potentially applicable to R. rubrum mtgA, provide a foundation for rational drug design approaches.

What are emerging research opportunities for R. rubrum mtgA studies?

Future research on R. rubrum mtgA should explore several promising directions:

Systems Biology Integration

Investigate how mtgA functions as part of the broader cellular network by:

  • Integrating transcriptomic, proteomic, and metabolomic data across growth conditions

  • Developing computational models of cell wall synthesis coordinated with central metabolism

  • Exploring the regulatory networks controlling mtgA expression and activity

Structural Biology Frontiers

Advances in structural biology techniques offer new opportunities:

  • Cryo-electron microscopy of mtgA in complex with substrates or interacting proteins

  • Time-resolved structural studies to capture reaction intermediates

  • Molecular dynamics simulations to understand conformational changes during catalysis

Synthetic Biology Applications

R. rubrum mtgA could be engineered for various applications:

  • Creating modified enzymes with altered substrate specificity

  • Developing biosensors based on transglycosylase activity

  • Engineering R. rubrum strains with modified cell wall properties for biotechnology applications

Comparative Biology

Expanding studies to related organisms will provide evolutionary context:

  • Comparing mtgA function across photosynthetic bacteria

  • Investigating adaptation of cell wall synthesis to different ecological niches

  • Exploring horizontal gene transfer events that may have shaped mtgA evolution

How might R. rubrum mtgA research intersect with sustainable biotechnology?

R. rubrum has received attention for its potential in sustainable biotechnology, particularly biohydrogen production . mtgA research could intersect with these applications:

  • Cell wall engineering for improved bioproduction:

    • Creating strains with modified cell walls for enhanced stress tolerance

    • Optimizing growth and division under bioproduction conditions

    • Improving cell integrity during fermentation processes

  • CO tolerance adaptations:

    • Studies show R. rubrum can be adapted to high CO levels through laboratory evolution

    • Understanding how cell wall synthesis adapts during this process

    • Potential coordination between mtgA activity and CO metabolism

  • Light/dark transitions in bioproduction:

    • R. rubrum shows profound differences in metabolism between light and dark conditions

    • Cell wall synthesis requirements likely vary across these transitions

    • mtgA regulation may be key to optimal growth under variable conditions

These intersections highlight the potential broader impact of fundamental research on R. rubrum mtgA beyond basic microbiology into applied biotechnology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.