Recombinant Rhodospirillum rubrum NAD (P) transhydrogenase subunit alpha part 2 (pntAB)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
pntAB; nntA2; Rru_A2182; NAD(P transhydrogenase subunit alpha part 2; Nicotinamide nucleotide transhydrogenase subunit alpha 2; Proton-translocating transhydrogenase component 2; Pyridine nucleotide transhydrogenase subunit alpha 2; dII
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-139
Protein Length
full length protein
Species
Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)
Target Names
pntAB
Target Protein Sequence
MEDKNILVEGFNQLSQQALELSQHAQALALQASHAVLPAAAATEGASEFWWLMTVFVLAC FIGFYVVWSVTPALHSPLMGVTNAISSVIVVGALIATGPEAFSASKVLGFFAILLASVNI FGGFIVTQRMLAMFKKKQK
Uniprot No.

Target Background

Function
The transhydrogenation between NADH and NADP is coupled to respiration and ATP hydrolysis, functioning as a proton pump across the membrane.
Database Links
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the pntAB gene in Rhodospirillum rubrum and how does it compare to homologous genes in other organisms?

The pntAB gene in Rhodospirillum rubrum encodes one of the three subunits of the proton-translocating nicotinamide nucleotide transhydrogenase. According to genomic analyses, R. rubrum has a cluster of three genes (pntAA, pntAB, and pntB) that encode the complete transhydrogenase enzyme . The pntAB gene specifically encodes a polypeptide of 139 amino acids that corresponds to the strongly hydrophobic domain IIa, which in Escherichia coli forms the C-terminal part of the α polypeptide .

This organization differs significantly from the transhydrogenase genes in E. coli, which consist of only two polypeptides (α and β), and from bovine mitochondria, where the enzyme is encoded by a single polypeptide . Despite these structural differences, sequence analysis reveals close similarity between the R. rubrum pntAB and corresponding regions in other organisms, suggesting functional conservation across species .

The evolutionary significance of this three-gene arrangement remains an active area of research. This unique gene structure in R. rubrum provides an excellent model for studying how different organisms have evolved various organizational strategies for this essential energy-coupling enzyme while maintaining functional conservation.

What is the functional role of pntAB in the NAD(P) transhydrogenase enzyme complex?

The pntAB subunit plays a crucial role in the proton-translocation mechanism of the NAD(P) transhydrogenase enzyme complex. The enzyme catalyzes the hydride transfer from NADH to NADP+, a reaction that is endergonic under physiological conditions and must be energized by the proton motive force (pmf) .

The pntAB subunit corresponds to the strongly hydrophobic domain IIa that is involved in transmembrane proton transport . This domain forms part of the membrane-spanning region of the enzyme that couples the hydride transfer reaction occurring in the peripheral nucleotide binding sites to the transmembrane proton transport .

Recent structural and functional studies indicate that this coupling mechanism involves long-distance conformational changes that connect the hydride transfer activity in the peripheral domains (mediated by pntAA and pntB) with proton translocation across the membrane via the hydrophobic domain containing pntAB . The enzyme can function bidirectionally, serving both as a proton pump driven by NADPH oxidation and as a NADPH-producing enzyme powered by the proton motive force .

The unique three-gene organization in R. rubrum may offer evolutionary advantages or specialized regulatory control compared to the two-polypeptide or single-polypeptide organizations found in other organisms, while maintaining the core coupling mechanism between nucleotide binding and proton translocation.

What experimental approaches can verify the membrane topology of pntAB?

Determining the membrane topology of pntAB requires a multi-method approach due to its hydrophobic nature and the challenges associated with membrane protein analysis. The following methodological strategies provide complementary information:

Cysteine Scanning Mutagenesis:
This approach involves systematically replacing amino acids with cysteine residues and then assessing their accessibility to membrane-impermeable sulfhydryl reagents. The method provides direct experimental evidence for the membrane disposition of specific residues:

  • Generate a cysteine-free version of pntAB as a background

  • Introduce single cysteines at positions throughout the protein sequence

  • Express in a suitable host and prepare membrane vesicles

  • React with membrane-impermeable (e.g., MTSET) and membrane-permeable (e.g., NEM) sulfhydryl reagents

  • Analyze modification patterns to determine which regions are accessible from which side of the membrane

Reporter Fusion Approaches:
This technique uses fusion proteins to report on the cellular location of different parts of pntAB:

  • Create C-terminal and internal fusions with reporter proteins like alkaline phosphatase (active in periplasm) or GFP (fluorescent in cytoplasm)

  • Express in bacterial systems and measure reporter activity

  • Map regions based on reporter activity patterns to establish a topology model

Protease Protection Assays:
This method exploits the fact that regions embedded in the membrane or facing the interior of membrane vesicles are protected from proteolytic digestion:

  • Prepare inside-out and right-side-out membrane vesicles containing pntAB

  • Treat with proteases like trypsin or proteinase K

  • Analyze digestion patterns using SDS-PAGE and Western blotting with region-specific antibodies

  • Protected fragments indicate membrane-embedded or interior-facing regions

This combination of approaches provides comprehensive evidence for the membrane topology of pntAB, allowing researchers to develop accurate structural models essential for understanding its role in proton translocation.

What experimental designs best elucidate the coupling mechanism between pntAB and the catalytic domains?

Elucidating the coupling mechanism between the membrane-embedded pntAB and the catalytic domains requires sophisticated experimental designs that capture the long-distance conformational changes essential for energy transduction. The following strategies are particularly effective:

Disulfide Cross-linking Analysis:
This approach can identify dynamic interactions between pntAB and other subunits during the catalytic cycle:

  • Introduce pairs of cysteine residues at predicted interaction interfaces between pntAB and other subunits

  • Measure cross-linking efficiency under different conditions (nucleotide-bound states, pH conditions)

  • Map conformational changes induced by substrate binding or proton movement

EPR Spectroscopy with Site-Directed Spin Labeling:
This technique provides information about distances between specific residues and their changes during catalysis:

  • Introduce cysteine residues at strategic positions and label with nitroxide spin labels

  • Measure distances between spin labels using DEER (Double Electron-Electron Resonance) spectroscopy

  • Monitor distance changes under different functional states

  • Construct dynamic models of conformational coupling

Reconstitution Systems with Fluorescent Probes:
Reconstituted systems allow simultaneous monitoring of hydride transfer and proton translocation:

MeasurementFluorescent ProbeInformation Obtained
Hydride TransferNADH/NADPH FluorescenceReal-time nucleotide conversion
Proton TranslocationACMA or PyranineInternal vesicle acidification
Conformational ChangesSite-specific FRET pairsDomain movements during catalysis

The experimental setup involves:

  • Co-reconstituting purified pntAA, pntAB, and pntB into liposomes

  • Incorporating appropriate fluorescent probes

  • Simultaneously monitoring multiple parameters during catalysis

  • Testing the effects of mutations in pntAB on the coupling efficiency

Chimeric Protein Approach:
Creating chimeric proteins between R. rubrum and E. coli transhydrogenases can identify regions critical for coupling:

  • Construct chimeras where pntAB is replaced with the corresponding region from E. coli

  • Assess the function of chimeric complexes in proton translocation and hydride transfer

  • Map regions essential for maintaining coupling between the processes

By combining these approaches, researchers can develop a comprehensive model of how the membrane-embedded pntAB transmits conformational changes between the proton channel and the nucleotide-binding domains, elucidating the molecular mechanism of energy transduction in this fascinating enzyme complex.

How can researchers analyze data contradictions in pntAB structure-function studies?

When confronted with contradictory data in pntAB structure-function studies, researchers should employ a systematic approach to resolve these discrepancies through rigorous analysis and validation. This methodological framework helps distinguish genuine biological phenomena from technical artifacts:

Systematic Classification of Contradictions:
Begin by categorizing contradictions based on their nature:

  • Methodological Contradictions: Different experimental approaches yielding conflicting results

  • Condition-Dependent Contradictions: Variations in experimental conditions leading to different outcomes

  • Interpretation Contradictions: Same data with different interpretational frameworks

Cross-Validation Matrix:
Create a systematic cross-validation matrix to evaluate contradictory findings:

FindingMethod 1Method 2Method 3Consistency Score
Structure A+-+2/3
Function B++-2/3
Interaction C--+1/3

For each finding, record whether different methods support (+) or contradict (-) it, then calculate a consistency score. Findings with low consistency scores warrant further investigation.

Reproduction with Methodological Variations:
When contradictions are identified, design experiments that specifically address potential sources of discrepancy:

  • Reproduce experiments using identical protocols between laboratories

  • Systematically vary critical parameters (detergents, lipid composition, protein purification methods)

  • Develop positive and negative controls that can validate assay sensitivity and specificity

Statistical Meta-Analysis:
Apply statistical approaches similar to those used in clinical contradiction detection :

  • Standardize data from multiple studies to allow direct comparison

  • Apply random-effects models to account for inter-study variability

  • Perform sensitivity analyses to identify factors driving contradictory results

  • Calculate confidence intervals to assess the reliability of findings

Cooperative Resolution Strategy:
When persistent contradictions remain:

  • Establish collaborations between groups reporting conflicting results

  • Develop a shared experimental protocol with clearly defined variables

  • Consider if contradictions reflect different functional states or conformations

  • Design definitive experiments that can discriminate between competing models

By systematically analyzing contradictions through this framework, researchers can transform seemingly conflicting data into a more nuanced understanding of pntAB structure and function, potentially revealing important aspects of its mechanism that might be obscured by simplistic models.

What are the optimal parameters for measuring proton translocation activity mediated by pntAB?

Accurately measuring proton translocation activity mediated by pntAB requires careful optimization of experimental parameters to ensure reliable and reproducible results. The following parameters are critical for obtaining meaningful measurements:

Liposome Composition and Preparation:
The lipid environment significantly impacts proton translocation activity:

  • Optimal Lipid Composition:

    • E. coli polar lipid extract (70% PE, 20% PG, 10% cardiolipin) closely mimics bacterial membranes

    • Synthetic mixtures should maintain this approximate ratio

    • Lipid charge density affects both protein incorporation and proton retention

  • Liposome Size and Homogeneity:

    • Extrude through 400 nm filters for maximal internal volume

    • Verify size distribution using dynamic light scattering

    • Smaller vesicles (100 nm) may be preferred for fluorescence-based assays due to lower light scattering

Protein Reconstitution Parameters:
The protein-to-lipid ratio and reconstitution method significantly impact activity:

ParameterOptimal RangeRationale
Protein:Lipid Ratio1:50 to 1:200 (w/w)Balance between activity signal and protein aggregation
DetergentDDM or LMNGMaintain protein stability during reconstitution
Detergent RemovalBio-Beads SM-2, 4-6 hoursGentle removal preserves protein structure

Measurement Conditions:
The buffer composition and experimental setup must be optimized for maximum sensitivity:

  • Buffer Composition:

    • Low buffering capacity (1-5 mM) to maximize pH changes

    • 100-150 mM KCl to maintain osmolarity

    • pH 7.0-7.5 for optimal enzyme activity

    • Absence of permeant ions that could dissipate gradients

  • Fluorescent Probe Selection:

    • ACMA (9-amino-6-chloro-2-methoxyacridine): Sensitive to ΔpH, non-permeant

    • Pyranine: Ratiometric pH indicator for quantitative measurements

    • Oxonol VI: For measuring membrane potential component

  • Measurement Parameters:

    • Temperature: 25°C (balance between activity and stability)

    • Stirring: Continuous gentle stirring to maintain suspension homogeneity

    • Nucleotide concentrations: 50-200 μM NADH/NADPH for optimal activity

Calibration and Controls:
Essential for quantitative interpretation:

  • Establish pH calibration curves for fluorescent probes

  • Include ionophore controls (nigericin for ΔpH, valinomycin for Δψ)

  • Perform parallel measurements of nucleotide binding/hydride transfer

By carefully optimizing these parameters, researchers can obtain reliable measurements of pntAB-mediated proton translocation, enabling quantitative assessment of how mutations or experimental conditions affect this critical aspect of transhydrogenase function.

How should researchers reconcile contradictory data about the proton translocation mechanism involving pntAB?

Contradictory data about proton translocation mechanisms is common in membrane protein research due to the complexity of these systems. Researchers should employ a structured approach to reconcile such contradictions:

Systematic Contradiction Detection:
Apply methodologies similar to clinical contradiction detection to identify and categorize discrepancies:

  • Extract specific claims about the proton translocation mechanism from literature

  • Identify pairs of claims that directly contradict each other

  • Evaluate the experimental evidence supporting each contradictory claim

  • Determine whether contradictions are fundamental or reflect different experimental conditions

Unified Mechanistic Framework:
Develop a comprehensive framework that may accommodate seemingly contradictory observations:

  • Consider if contradictions reflect different states in a complex mechanism rather than mutually exclusive models

  • Identify conditions under which each mechanism might predominate

  • Develop testable predictions that can distinguish between alternative models

Critical Evaluation of Methodological Differences:
Examine how methodological variations might explain contradictory results:

Integrative Experimental Design:
Design experiments specifically to resolve contradictions:

  • Combine multiple measurement techniques in the same experimental setup

  • Simultaneously monitor proton translocation and conformational changes

  • Use site-directed mutagenesis to test specific mechanistic predictions

  • Apply time-resolved techniques to capture transient intermediates

Collaborative Resolution:
Establish direct collaboration between laboratories reporting contradictory results:

  • Exchange materials (protein constructs, liposome preparations)

  • Perform parallel experiments with identical protocols

  • Jointly develop new methodologies that may overcome limitations of current approaches

This systematic approach transforms contradictions from obstacles into opportunities for deeper mechanistic understanding, potentially revealing nuances in the proton translocation mechanism that were not apparent in simpler models.

What statistical methods are appropriate for analyzing site-directed mutagenesis data for pntAB?

Hierarchical Mutational Analysis:
This approach systematically categorizes mutations by their location and predicted impact:

Multiple Parameter Correlation Analysis:
Many mutations affect multiple aspects of function, requiring multivariate analysis:

  • Measure multiple parameters for each mutant:

    • Hydride transfer rates

    • Proton translocation efficiency

    • Binding affinities for nucleotides

    • Protein stability

  • Apply principal component analysis (PCA) or factor analysis to:

    • Identify patterns of covariation between parameters

    • Reduce dimensionality of complex datasets

    • Reveal underlying mechanistic relationships

Table 1: Recommended Statistical Tests for Different Data Types

Data TypeAppropriate TestsAdvantagesImplementation
Activity ComparisonsOne-way ANOVA with Dunnett's post-hocCompares multiple mutants to wild-type controlR (stats package), GraphPad Prism
Dose-Response DataNon-linear regression with extra sum-of-squares F-testDetermines if curves differ significantlyGraphPad Prism, R (drc package)
Multi-parameter DataMANOVA, PCAAccounts for correlations between parametersR (stats, FactoMineR packages)
Non-normal DistributionsKruskal-Wallis with Dunn's post-hocRobust to outliers and non-normal distributionsR (FSA package), GraphPad Prism

Regression Models for Structure-Function Relationships:
For comprehensive datasets with multiple mutations:

  • Develop regression models where:

    • Dependent variable: Functional parameter (e.g., proton translocation rate)

    • Independent variables: Structural parameters (e.g., hydrophobicity, charge, volume change)

  • Test different model formulations:

    • Linear models for additive effects

    • Interaction terms for coupled effects

    • Non-linear models for complex relationships

Bayesian Analysis for Uncertainty Quantification:
Bayesian approaches provide robust uncertainty estimates, particularly valuable for complex systems:

By applying these statistical methods, researchers can extract maximum information from mutagenesis data, identifying critical residues involved in proton translocation and distinguishing between direct functional effects and indirect structural perturbations.

How can researchers effectively compare transhydrogenase data across different experimental systems?

Comparing transhydrogenase data across different experimental systems presents significant challenges due to variations in protein constructs, expression systems, and assay conditions. A methodical approach to cross-system comparison enables meaningful integration of diverse datasets:

Standardization of Measurement Parameters:
Develop standardized metrics that allow direct comparison:

  • Normalized Activity Measures:

    • Specific activity per unit protein

    • Turnover number (kcat) rather than raw activity

    • Coupling ratios (protons translocated per hydride transferred)

  • Relative Comparisons:

    • Express mutant activities as percentage of wild-type measured under identical conditions

    • Calculate fold-changes in response to specific perturbations

Meta-Analysis Framework:
Apply rigorous meta-analytical approaches adapted from clinical research :

  • Establish inclusion criteria for studies based on methodological quality

  • Extract standardized effect sizes from each study

  • Apply random-effects models to account for inter-study heterogeneity

  • Perform subset analyses based on experimental conditions

Table 2: Cross-System Normalization Approaches

Variable FactorNormalization MethodExample
Protein Expression SystemNormalization to purified reference proteinSet activity of purified wild-type from each system as 100%
Lipid EnvironmentReconstitution efficiency correctionNormalize to protein:lipid ratio and orientation factor
Assay ConditionsTemperature and pH correction factorsApply Arrhenius equation for temperature normalization
Protein ConstructDomain-specific activity normalizationCompare equivalent domains rather than different construct lengths

Dimensional Analysis:
Rather than directly comparing absolute values, compare dimensionless parameters:

  • Equilibrium constants (Keq)

  • Coupling ratios (H+/hydride)

  • Efficiency metrics (energy transduction efficiency)

Bridging Experiments:
Design experiments specifically to bridge between different systems:

  • Create hybrid systems with components from different sources

  • Test identical mutations across different expression systems

  • Perform parallel assays using multiple methodologies on the same samples

Multivariate Normalization:
For complex datasets from different systems:

  • Identify a core set of measurements common to all systems

  • Apply multivariate scaling techniques (e.g., z-score normalization within systems)

  • Use PCA or other dimension reduction techniques to identify system-independent patterns

By systematically addressing the challenges of cross-system comparison, researchers can integrate data from diverse experimental approaches, leading to a more comprehensive understanding of transhydrogenase function across different biological contexts and experimental platforms.

What purification protocol optimizes yield and activity for recombinant pntAB studies?

Optimizing purification of the hydrophobic pntAB subunit requires a carefully designed protocol that balances protein yield with preserved structural integrity and function. The following comprehensive protocol addresses the specific challenges of this membrane protein:

Expression System Optimization:
The choice of expression system significantly impacts both yield and quality:

  • Bacterial Expression:

    • Host: E. coli C41(DE3) or C43(DE3) strains specialized for membrane proteins

    • Vector: pET-based with C-terminal His6-tag and TEV protease cleavage site

    • Induction: 0.2 mM IPTG at OD600 = 0.6-0.8, followed by 18°C overnight expression

    • Media: Terrific Broth supplemented with 0.5% glucose to enhance membrane production

  • Alternative Systems:

    • Cell-free expression systems for difficult constructs

    • Fusion partners (MBP, SUMO) to enhance solubility

Membrane Preparation:
Careful membrane isolation preserves native environment until solubilization:

  • Cell disruption via French press (15,000 psi, 3 passes) in buffer containing protease inhibitors

  • Low-speed centrifugation (10,000 × g, 20 min) to remove cell debris

  • Ultracentrifugation (150,000 × g, 1 hour) to collect membrane fraction

  • Membrane washing with high-salt buffer (500 mM NaCl) to remove peripheral proteins

Detergent Screening and Solubilization:
The choice of detergent is critical for maintaining pntAB structure and function:

Table 3: Detergent Screening Results for pntAB Solubilization

Optimal solubilization conditions:

  • 1% DDM in 20 mM HEPES pH 7.5, 300 mM NaCl, 5% glycerol, 1 mM DTT

  • Gentle agitation for 2 hours at 4°C

  • Ultracentrifugation (150,000 × g, 30 min) to remove insoluble material

Purification Strategy:
A multi-step purification approach yields highest purity while preserving activity:

  • IMAC Purification:

    • Ni-NTA resin with gradient elution (20-300 mM imidazole)

    • Critical washing step with 50 mM imidazole to remove non-specific binding

    • Addition of 0.05% DDM in all buffers to maintain solubilization

  • Size Exclusion Chromatography:

    • Superdex 200 column in 20 mM HEPES pH 7.5, 150 mM NaCl, 0.03% DDM

    • Collection of monodisperse peak fractions

    • Analysis by SDS-PAGE and Western blotting

  • Optional Ion Exchange:

    • For highest purity requirements: HiTrap Q column at pH 8.0

    • Gradient elution with 0-500 mM NaCl

Stability Enhancement:
Several additives significantly enhance pntAB stability during purification:

  • Lipid supplementation: 0.1 mg/mL E. coli lipid extract

  • Glycerol: 10% reduces aggregation

  • Cholesteryl hemisuccinate: 0.01% stabilizes protein-detergent complexes

This optimized protocol balances the competing demands of yield, purity, and activity preservation, enabling downstream structural and functional studies of the pntAB subunit with minimal compromise to its native properties.

What are the most effective methods for analyzing pntAB-associated protein-protein interactions?

Investigating protein-protein interactions involving the membrane-embedded pntAB subunit requires specialized approaches that accommodate its hydrophobic nature while providing meaningful interaction data. The following methods are particularly effective:

In Situ Cross-linking Approaches:
Chemical cross-linking performed prior to extraction identifies native interactions:

  • Site-specific Cross-linking:

    • Introduce cysteine residues at predicted interaction interfaces

    • Apply oxidative cross-linking or bifunctional sulfhydryl reagents

    • Analyze cross-linked products by SDS-PAGE and mass spectrometry

  • Non-specific Cross-linking:

    • Apply membrane-permeable cross-linkers with varying spacer lengths (DSS, BS3)

    • Perform time-course and concentration-dependent studies

    • Identify cross-linked peptides by LC-MS/MS analysis

Table 4: Cross-linking Reagents for pntAB Interaction Studies

Cross-linkerSpacer LengthSpecificityApplication
DSS/BS311.4 ÅAmine-reactiveGeneral interaction mapping
SMCC8.3 ÅAmine/sulfhydrylHeterobifunctional linking
BMOE8.0 ÅSulfhydryl-specificPrecise distance measurement
EDC0 ÅCarboxyl/amineZero-length cross-linking
MTS reagentsVariableSulfhydryl-specificSite-directed cross-linking

Co-purification Strategies:
Modified pull-down approaches suitable for membrane protein complexes:

  • Tandem Affinity Purification:

    • Engineer constructs with orthogonal tags on different subunits

    • Perform sequential purification to isolate intact complexes

    • Maintain detergent concentrations above CMC throughout

  • GFP-based Strategies:

    • Utilize GFP-nanotrap for efficient one-step purification

    • Compatible with fluorescence-detection size-exclusion chromatography (FSEC)

    • Enables pre-purification quality assessment

Protein Complementation Assays:
Modified split-protein approaches for membrane protein interactions:

  • Split-GFP Complementation:

    • Attach GFP fragments to putative interacting proteins

    • Fluorescence indicates successful interaction

    • Particularly useful for in vivo interaction verification

  • Split-ubiquitin System:

    • Specifically designed for membrane protein interactions

    • Reconstitution of ubiquitin leads to reporter gene activation

    • Allows screening of interaction partners in yeast

Advanced Biophysical Methods:
Specialized techniques for detailed interaction characterization:

  • Microscale Thermophoresis (MST):

    • Measures interactions based on thermophoretic mobility changes

    • Requires minimal sample amounts

    • Compatible with detergent-solubilized membrane proteins

  • Single-molecule FRET:

    • Site-specific labeling of interacting partners

    • Provides dynamic information about interaction states

    • Can detect transient interactions missed by ensemble methods

  • Native Mass Spectrometry:

    • Direct measurement of intact complexes

    • Provides stoichiometry information

    • Requires specialized detergent removal approaches (e.g., nanodiscs)

By combining these complementary approaches, researchers can build a comprehensive picture of how pntAB interacts with other transhydrogenase subunits and potentially with other cellular components, providing insights into both the structural organization and functional regulation of this important enzyme complex.

How can isotope labeling techniques advance understanding of pntAB-mediated proton translocation?

Isotope labeling techniques provide powerful tools for investigating the proton translocation mechanism involving pntAB. These approaches allow researchers to track specific atoms and molecular movements during the catalytic cycle:

Hydrogen/Deuterium Exchange Mass Spectrometry (HDX-MS):
HDX-MS reveals conformational dynamics and solvent accessibility of different protein regions:

  • Experimental Approach:

    • Purify pntAB in detergent micelles or reconstitute into nanodiscs

    • Initiate exchange by dilution into D₂O-based buffer

    • Quench exchange at various timepoints by shifting to pH 2.5

    • Analyze deuterium incorporation by pepsin digestion and LC-MS

  • Mechanistic Insights:

    • Identify regions that undergo conformational changes during catalysis

    • Map the solvent accessibility of putative proton transfer pathways

    • Compare exchange patterns in different functional states (e.g., with different nucleotides bound)

Table 5: HDX-MS Strategy for pntAB Functional Analysis

Functional StatePreparation MethodExpected OutcomeMechanistic Implication
Resting StateNo substrateBaseline exchange patternReference state
NADH-boundPre-incubation with NADHChanges in pntAA-pntAB interfaceConformation for hydride transfer
NADPH-boundPre-incubation with NADPHChanges in proton channel regionProton translocation pathway
pmf-energizedReconstitution with pH gradientProtected regions in pntABConformation driven by proton gradient

Site-specific Isotope Labeling:
Strategically placed isotopes can track specific processes:

  • ¹⁵N/¹³C Labeling of Key Residues:

    • Express protein with isotopically labeled amino acids at specific positions

    • Focus on residues predicted to participate in proton relay

    • Monitor chemical shift changes using solid-state NMR

  • Selective Deuteration:

    • Express protein in media containing D₂O and protonated precursors

    • Creates specific patterns of deuteration that simplify NMR spectra

    • Enables focus on regions of interest despite large protein size

Kinetic Isotope Effects (KIEs):
KIEs provide direct evidence of rate-limiting steps involving proton transfer:

  • Solvent Isotope Effects:

    • Compare enzyme activity in H₂O vs. D₂O

    • Large effects (>2) suggest proton transfer in rate-limiting step

    • Temperature dependence can reveal quantum mechanical tunneling

  • Heavy Atom Isotope Effects:

    • Utilize ¹⁸O or ¹⁵N labeling at specific sites

    • Measure small but significant effects on reaction rates

    • Provides atom-specific involvement in chemical steps

Real-time Proton Tracking:
Specialized techniques for following proton movements:

  • Magic Angle Spinning NMR:

    • Monitor protonation states of key residues in membrane-embedded protein

    • Track changes in chemical shifts during catalytic cycle

    • Correlate with functional states determined by other methods

  • Time-resolved IR Spectroscopy:

    • Detect protonation/deprotonation events of carboxylic acids and other proton carriers

    • Follow structural changes associated with proton movement

    • Microsecond time resolution captures transient intermediates

By integrating these isotope labeling approaches, researchers can develop a comprehensive atomic-level understanding of how pntAB facilitates proton translocation, providing mechanistic insights into the coupling between this process and the hydride transfer reactions occurring at the peripheral nucleotide-binding domains.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.