Recombinant Rhodospirillum rubrum Protein CrcB homolog (crcB)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant CrcB homolog is synthesized using standard molecular biology techniques:

  • Expression Host: E. coli (commonly used for high-yield protein production) .

  • Tagging: The tag type (e.g., His-tag, GST-tag) is determined during production, as no fixed tag is specified in available products .

  • Purity: Greater than 90% as verified by SDS-PAGE .

Key Observations:

  • Sequence Homology: Aligns with CrcB-family proteins, which in other organisms mediate fluoride resistance or participate in stress responses .

  • Functional Gaps: No published studies link R. rubrum CrcB to specific metabolic pathways (e.g., photosynthesis, PHA biosynthesis) or redox regulation, unlike other R. rubrum proteins such as PpaA/AerR .

Comparative Analysis with Homologs

Table 2: Functional Insights from CrcB Homologs

SpeciesProposed FunctionKey Evidence
E. coli O127:H6 Fluoride resistance/membrane transportSequence homology to CrcB-family proteins
Rhodospirillum centenum Camphor resistanceSubcellular localization (inner membrane)
R. rubrum UndeterminedNo functional data in literature; structural studies pending

Future Research Directions

  1. Functional Characterization: Knockout or overexpression studies in R. rubrum to identify its role in stress adaptation or metabolic regulation.

  2. Interaction Mapping: Co-IP or affinity chromatography to identify binding partners, potentially linking it to known pathways (e.g., PHA synthesis , nitrogen fixation ).

  3. Biotechnological Applications: Exploring its utility in bioengineering R. rubrum for enhanced PHA production or hydrogen synthesis .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will strive to accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipment, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. You can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preference for a particular tag type, please inform us, and we will prioritize its inclusion.
Synonyms
crcB; Rru_A0236; Putative fluoride ion transporter CrcB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-129
Protein Length
full length protein
Species
Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)
Target Names
crcB
Target Protein Sequence
MTYLFVAAGGALGSTLRYWLSGLIAGAIGQSFPWGTLVINISGSIVIGAFATLTGPDGRV FIPGDWRQFFMVGVCGGYTTFSSFSLQTLTLAQEGQGLWAAANVVLSVVFCLIGVWLGHV GAVLINEGV
Uniprot No.

Target Background

Function
This protein plays a crucial role in reducing fluoride concentration within the cell, thereby mitigating its toxicity.
Database Links
Protein Families
CrcB (TC 9.B.71) family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the function of CrcB homolog in Rhodospirillum rubrum?

The CrcB homolog in R. rubrum likely plays a role in cellular homeostasis, potentially relating to the organism's redox state regulation. Similar to other R. rubrum proteins such as the PpaA/AerR-like protein (HP1), CrcB homolog may be involved in regulatory networks that extend beyond a single cellular process. Research on the PpaA/AerR-like protein demonstrated that proteins in R. rubrum can affect multiple biological processes despite appearing to have narrower functions based on their genomic context . When investigating CrcB function, researchers should consider potential roles in both primary metabolic processes and secondary cellular responses.

What expression systems are recommended for recombinant production of R. rubrum CrcB homolog?

For recombinant expression of R. rubrum proteins including CrcB homolog, E. coli-based expression systems using vectors such as pVSOP have shown success with other R. rubrum proteins. The expression can be controlled using inducible promoters like the Pm-XylS system, which has been effective for other R. rubrum proteins . When designing your expression construct, consider:

  • Codon optimization based on E. coli codon usage

  • Inclusion of appropriate fusion tags for detection and purification

  • Testing multiple induction conditions (temperature, inducer concentration, duration)

  • Evaluating protein solubility through small-scale expression tests before scaling up

Compare protein expression levels using both traditional SDS-PAGE analysis and Western blotting to confirm identity and integrity of the expressed protein.

What purification strategy should be employed for recombinant CrcB homolog?

For recombinant CrcB homolog purification, a multi-step chromatography approach is recommended:

  • Initial capture using affinity chromatography (if the protein is expressed with a tag)

  • Intermediate purification using ion exchange chromatography

  • Polishing step with size exclusion chromatography

Protein stability should be assessed throughout purification by implementing the following protocol:

StepMethodBuffer ConditionsExpected Results
CaptureNi-NTA (for His-tagged proteins)50 mM Tris-HCl, pH 8.0, 300 mM NaCl, 10-250 mM imidazole>80% purity
IntermediateAnion/Cation Exchange20 mM Tris-HCl, pH 8.0, 0-500 mM NaCl gradient>90% purity
PolishingSize Exclusion20 mM Tris-HCl, pH 8.0, 150 mM NaCl>95% purity

Based on experience with R. rubrum proteins, include reducing agents like DTT or β-mercaptoethanol in all buffers to maintain thiol groups in reduced state, as many bacterial regulatory proteins contain redox-sensitive cysteine residues .

How does the structure of CrcB homolog compare to other known bacterial proteins?

When analyzing CrcB homolog structure, researchers should perform comparative structural analysis using both computational and experimental approaches:

  • Sequence alignment with known CrcB homologs from other bacteria

  • Homology modeling based on crystallized bacterial transporters

  • Experimental structure determination through X-ray crystallography or cryo-EM

Based on research with other R. rubrum proteins, it's important to note that sequence similarity doesn't always translate to functional similarity. For example, the PpaA/AerR-like protein (HP1) in R. rubrum shows similarity to proteins containing the Cobalamin-B12 binding motif, but lacks the canonical cobalamin binding domain, suggesting evolutionary divergence while maintaining regulatory functions . This pattern suggests CrcB homolog may similarly have evolved unique structural features despite sequence conservation with other bacterial homologs.

What is the relationship between CrcB homolog and the photosynthetic gene cluster in R. rubrum?

The relationship between CrcB homolog and the Photosynthetic Gene Cluster (PGC) should be investigated using transcriptomic and genetic approaches. Research on R. rubrum has shown that regulatory proteins can have wide-ranging effects beyond their immediate genetic neighborhood. For instance, the PpaA/AerR-like protein located adjacent to the ppsR gene affects not only photosynthesis but also nitrogen fixation and other cellular processes .

To determine if CrcB homolog interacts with photosynthetic regulation:

  • Perform RNA-seq analysis of CrcB deletion mutants under various light and oxygen conditions

  • Create reporter fusions to monitor expression of key photosynthetic genes in wildtype vs. CrcB mutant backgrounds

  • Analyze protein-protein interactions between CrcB homolog and known photosynthetic regulators like PpsR

Research on R. rubrum shows that proteins can have broad regulatory impacts, with transcriptomic analysis revealing connections between seemingly unrelated cellular systems .

How does redox state affect CrcB homolog function in R. rubrum?

To investigate redox regulation of CrcB homolog, consider that R. rubrum proteins often respond to the intracellular redox state, as seen with the PpaA/AerR-like protein . Design experiments that:

  • Compare protein activity under different redox conditions (aerobic, microaerobic, anaerobic)

  • Examine the effects of redox-active compounds on protein function

  • Identify potential redox-sensitive residues through site-directed mutagenesis

Create a standardized experimental setup that controls for:

  • Dissolved oxygen concentration

  • Light intensity and wavelength

  • Carbon source availability

  • Growth phase of cultures

This approach will help distinguish direct redox effects from secondary metabolic responses, as R. rubrum has complex regulatory networks that integrate multiple environmental signals .

What genetic tools are available for studying CrcB homolog in R. rubrum?

For genetic manipulation of CrcB homolog in R. rubrum, researchers should consider:

  • Gene deletion strategies:

    • Homologous recombination-based approaches

    • CRISPR-Cas9 systems adapted for R. rubrum

  • Complementation methods:

    • Plasmid-based expression using vectors like pVSOP with inducible promoters

    • Chromosomal integration at neutral sites

  • Reporter systems:

    • Transcriptional fusions with fluorescent proteins

    • Translational fusions for protein localization studies

When designing complementation experiments, it's important to test both native and modified protein versions. Research with other R. rubrum proteins shows that complementation can verify phenotypic effects, as demonstrated in studies with the PpaA/AerR-like protein where complementation with pVSOP_A0625S1 restored pigment formation in deletion mutants .

What challenges might arise when analyzing CrcB homolog interactions with other cellular components?

When investigating protein-protein or protein-DNA interactions involving CrcB homolog, researchers might encounter these challenges:

  • Non-specific binding in in vitro assays

  • Competition from endogenous proteins in pull-down experiments

  • Difficulty distinguishing direct from indirect interactions in complex networks

  • Capturing transient interactions that depend on specific cellular conditions

To address these challenges:

  • Use multiple complementary techniques (Y2H, co-IP, FRET, ChIP-seq)

  • Include appropriate controls to validate specificity

  • Consider crosslinking approaches to capture transient interactions

  • Verify in vitro findings with in vivo functional assays

Research on R. rubrum proteins indicates that regulatory proteins can have broad effects on gene expression networks, requiring careful experimental design to distinguish direct regulatory targets from downstream effects .

How can transcriptomic approaches enhance understanding of CrcB homolog function?

Transcriptomic analysis can provide valuable insights into CrcB homolog function by:

  • Identifying genes differentially expressed in CrcB mutants

  • Revealing potential regulatory networks

  • Uncovering unexpected functional connections

When designing transcriptomic experiments for CrcB research:

  • Compare multiple conditions (aerobic/anaerobic, light/dark, different carbon sources)

  • Include appropriate time points to capture primary and secondary responses

  • Use biological replicates to ensure statistical significance

  • Validate key findings with RT-qPCR or reporter assays

Previous transcriptomic studies of R. rubrum deletion mutants have revealed surprising connections between different cellular systems. For example, analysis of the PpaA/AerR-like protein mutant demonstrated effects not only on bacteriochlorophyll and carotenoid biosynthesis but also on nitrogenase complex components and other biological processes .

How should researchers interpret apparent contradictions in CrcB homolog functional data?

When faced with seemingly contradictory data about CrcB homolog function:

  • Evaluate differences in experimental conditions:

    • Growth phase variations

    • Media composition differences

    • Environmental parameters (light, temperature, oxygen)

  • Consider protein modification states:

    • Post-translational modifications

    • Redox-dependent conformational changes

    • Complex formation with different partners under varied conditions

  • Examine genetic background effects:

    • Compensatory mutations

    • Strain-specific differences

    • Polar effects in gene deletion constructs

Research on R. rubrum proteins shows that they can have context-dependent functions. For example, the PpaA/AerR-like protein's effects on pigment synthesis depend on specific growth conditions, with different phenotypes observed under various light and oxygen regimens .

What bioinformatic approaches can help predict CrcB homolog function?

To predict CrcB homolog function using bioinformatics:

  • Employ multiple sequence alignment tools to identify conserved domains and residues

  • Use protein structure prediction algorithms to model potential functional sites

  • Analyze genomic context across multiple species to identify conserved gene neighborhoods

  • Implement co-expression network analysis to discover functional associations

Create a comprehensive analysis pipeline that integrates:

  • Phylogenetic analysis to trace evolutionary history

  • Structural modeling to predict ligand binding sites

  • Protein-protein interaction network analysis

  • Comparative genomics across multiple bacterial species

Research on R. rubrum proteins demonstrates that genomic context provides valuable insights. The proximity of regulatory genes to their targets, such as the PpaA/AerR-like protein's location next to ppsR, can suggest functional relationships that may be explored computationally before experimental validation .

How might CrcB homolog research contribute to understanding bacterial adaptation mechanisms?

Research on CrcB homolog could provide insights into bacterial adaptation through:

  • Elucidating novel regulatory mechanisms that integrate multiple environmental signals

  • Identifying previously unknown connections between metabolic pathways

  • Revealing evolutionary adaptations specific to photosynthetic bacteria

To maximize contributions to this field:

  • Compare CrcB function across phylogenetically diverse bacteria

  • Investigate CrcB response to various environmental stressors

  • Examine potential horizontal gene transfer events involving CrcB

  • Develop systems biology models that incorporate CrcB into cellular regulatory networks

Research on R. rubrum regulatory proteins suggests they often evolve unique functions while maintaining structural similarities to proteins in other bacteria. The PpaA/AerR-like protein, for example, appears to have evolved beyond its canonical role, losing specific domains while acquiring novel functions .

What novel analytical techniques might enhance CrcB homolog characterization?

Future research on CrcB homolog could benefit from emerging techniques such as:

  • Single-molecule tracking to monitor protein dynamics in vivo

  • Cryo-electron tomography to visualize protein complexes in their cellular context

  • Hydrogen-deuterium exchange mass spectrometry to map conformational changes

  • ChIP-seq and RNA-seq integration to connect direct binding events with transcriptional outcomes

When implementing these techniques, researchers should:

  • Develop appropriate controls specific to R. rubrum cellular properties

  • Optimize protocols to account for the unique characteristics of photosynthetic bacteria

  • Combine multiple approaches to build comprehensive functional models

  • Consider the impact of growth conditions on experimental outcomes

Building on research methodologies used for other R. rubrum proteins, these techniques can provide multidimensional data to create more comprehensive models of protein function within bacterial regulatory networks .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.