Recombinant Rhodospirillum rubrum Undecaprenyl-diphosphatase 2 (uppP2)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant UppP2 from R. rubrum is produced in Escherichia coli with an N-terminal His-tag, ensuring high purity (>90% by SDS-PAGE) . Key specifications include:

PropertyDetail
UniProt IDQ2RTE2
Gene NameuppP2 (Rru_A1803)
Protein LengthFull-length (1-274 amino acids)
Molecular Weight~31 kDa (calculated)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; 5–50% glycerol for long-term storage

The amino acid sequence includes conserved motifs implicated in catalytic activity, such as (E/Q)XXXE and PGXSRSXXT, which are critical for substrate binding and metal ion coordination .

Enzymatic Mechanism

UppP2 belongs to the pyrophosphatase family (EC 3.6.1.27) and requires Mg²⁺ or Ca²⁺ for activity . Structural and mutagenesis studies reveal:

  • Active Site Residues: Glu-17, Glu-21, His-30, Ser-173, Arg-174, and Thr-178 form a periplasmic-facing catalytic pocket .

  • Substrate Interaction: The enzyme binds the pyrophosphate moiety of C₅₅-PP via metal ion bridges and hydrogen bonds .

  • Kinetic Parameters: Mutations like E17A/E21A or R174A abolish activity, while H30A reduces catalytic efficiency by >90% .

Functional Roles in Bacterial Physiology

  • Cell Wall Biosynthesis: Converts C₅₅-PP to C₅₅-P, enabling lipid carrier recycling for peptidoglycan and teichoic acid synthesis .

  • Bacitracin Resistance: Overexpression of UppP2 counteracts bacitracin’s inhibition of cell wall assembly, linking it to antibiotic resistance .

  • Energy Metabolism: Homologous H⁺-pyrophosphatases in R. rubrum contribute to ATP synthesis during metabolic transitions, though UppP2’s direct role remains under study .

Research Applications

Recombinant UppP2 is utilized in:

  1. Antibiotic Development: Screening for inhibitors targeting lipid carrier recycling .

  2. Structural Biology: Crystallization trials to resolve membrane protein architectures .

  3. Enzyme Engineering: Directed evolution to enhance stability or alter substrate specificity .

Expression and Purification

ParameterDetail
Host SystemE. coli (high yield) or insect/mammalian cells (post-translational modifications)
Yield~50 µg per batch (scalable)
Purity AssuranceSDS-PAGE and mass spectrometry

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
uppP2; Rru_A1803; Undecaprenyl-diphosphatase 2; Bacitracin resistance protein 2; Undecaprenyl pyrophosphate phosphatase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-274
Protein Length
full length protein
Species
Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)
Target Names
uppP2
Target Protein Sequence
MDLVMLIKAAILGLVEGITEFLPISSTGHLIIAGSLLDFLDEQKRDVFVIVIQLGAILAV CWEYRRRLTDVVAGLGSDPQSWKFVTNLLIAFLPAVVLGLTFGKAIKAHLFSPVPVATAF IVGGLVILWAERRRHPIRVREVDEMTWVDALKIGLAQCFALIPGTSRSGATIIGGLFFGL SRKAATEFSFFLAIPTLTAASLYDLYKNRALLDGDMSGLMAVGFVVSFLSALVAVRGLIR YISRHDFTVFAWYRIAFGLVVLATAWSGLVSWSA
Uniprot No.

Target Background

Function
Catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) and confers bacitracin resistance.
Database Links
Protein Families
UppP family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Undecaprenyl-diphosphatase 2 (uppP2) and what is its role in bacterial cell wall synthesis?

Undecaprenyl-diphosphatase 2 (uppP2) is a membrane-bound enzyme that catalyzes the dephosphorylation of undecaprenyl diphosphate (UPP) to form undecaprenyl phosphate (UP). This reaction represents a critical step in bacterial cell wall biosynthesis. In the bacterial cell wall synthesis pathway, farnesyl diphosphate (FPP) condenses with 8 isopentenyl diphosphate (IPP) molecules to form undecaprenyl diphosphate (UPP) through the action of undecaprenyl diphosphate synthase (UPPS). Subsequently, uppP2 (EC 3.6.1.27) converts UPP to UP, which serves as a lipid carrier for peptidoglycan precursors . This function makes uppP2 an attractive target for antimicrobial development since it is not present in humans.

What are the structural and functional characteristics of R. rubrum uppP2?

R. rubrum uppP2 (UniProt accession: Q2RTE2) is a membrane-embedded enzyme also known as Bacitracin resistance protein 2. The full-length protein consists of 274 amino acid residues with a sequence that suggests multiple transmembrane domains. The amino acid sequence (MDLVmLIKAAILGLVEGITEFLPISSTGHLIIAGSLLDFLDEQKRDVFVIVIQLGAILAVCWEYRRRLTDVVAGLGSDPQSWKFVTNLLIAFLPAVVLGLTFGKAIKAHLFSPVPVATAFIVGGLVILWAERRRHPIRVREVDEMTWVDALKIGLAQCFALIPGTSRSGATIIGGLFFGLSRKAATEFSFFLAIPTLTAAASLYDLYKNRALLDGDMSGLMAVGFVVSFLSALVAVRGLIRYISRHDFTVFAWYRIAFGLVVLATAWSGLVSWSA) is rich in hydrophobic residues, consistent with its membrane localization . Functionally, uppP2 contributes to bacitracin resistance in bacteria by maintaining the pool of undecaprenyl phosphate necessary for cell wall synthesis, even in the presence of bacitracin, which normally sequesters UPP.

How does R. rubrum uppP2 compare with homologous enzymes in other bacterial species?

R. rubrum uppP2 shares functional similarities with undecaprenyl pyrophosphate phosphatases from other bacterial species, though with distinct structural features. While the E. coli UPPP (EcUPPP) and S. aureus UPPS (SaUPPS) have been more extensively characterized, R. rubrum uppP2 represents a unique variant within the photosynthetic purple nonsulfur bacteria. Comparing inhibition profiles between these enzymes reveals different susceptibilities to compounds. For instance, the table below shows varying IC₅₀ values (μM) of inhibitor compounds against bacterial growth and purified enzymes:

CompoundB. subtilis GrowthS. aureus GrowthSaUPPS InhibitionEcUPPP Inhibition
Compound 80.210.240.331.3
Compound 90.420.790.544.2
Compound 100.560.230.603.0
Compound 110.210.0820.780.83

These differences suggest structural variations in the active sites that could be exploited for species-specific inhibitor development .

What are the recommended methods for expressing and purifying recombinant R. rubrum uppP2?

Based on established protocols for similar membrane proteins, recombinant R. rubrum uppP2 can be expressed using a histidine-tag fusion strategy. The gene encoding uppP2 (Rru_A1803) should be PCR-amplified from R. rubrum genomic DNA (strain ATCC 11170 / NCIB 8255) and cloned into an expression vector containing an N-terminal or C-terminal His-tag . Expression in E. coli BL21(DE3) or a similar strain is recommended, with induction using IPTG at concentrations between 0.1-1.0 mM when cultures reach an OD₆₀₀ of 0.6-0.8.

For purification, a multi-step process is advisable:

  • Cell lysis using sonication or a French press in a buffer containing detergent (typically 1% DDM or 1% CHAPS)

  • Membrane fraction isolation through ultracentrifugation

  • Solubilization of membrane proteins using appropriate detergents

  • Ni²⁺-chelating affinity chromatography for His-tagged protein capture

  • Size-exclusion chromatography for final purification

The purified protein should be stored in a Tris-based buffer with 50% glycerol at -20°C or -80°C for extended storage. Repeated freeze-thaw cycles should be avoided, with working aliquots stored at 4°C for up to one week .

How can researchers verify the activity of purified recombinant uppP2?

Enzymatic activity of purified recombinant uppP2 can be verified through several complementary approaches:

  • Phosphate Release Assay: Measure inorganic phosphate released during the dephosphorylation of UPP using colorimetric methods like the malachite green assay. This approach quantifies the product of the reaction directly.

  • Substrate Depletion Assay: Monitor the decrease in UPP concentration using HPLC or LC-MS methods. This requires careful standardization but provides direct evidence of substrate utilization.

  • Complementation Studies: Verify functional activity by testing the ability of recombinant uppP2 to complement growth defects in bacterial strains with uppP mutations, following protocols similar to those used for R. rubrum mutant strain construction and complementation .

  • Inhibition Studies: Confirm the specificity of the purified enzyme by testing known inhibitors and comparing IC₅₀ values with published data .

When analyzing kinetic parameters, researchers should use the Michaelis-Menten equation to determine K<sub>m</sub> and V<sub>max</sub> values, employing Lineweaver-Burk or Eadie-Hofstee plots for data verification. All activity assays should include appropriate controls, including heat-inactivated enzyme and reactions without enzyme.

What experimental design principles should be applied when studying uppP2 inhibition?

When designing experiments to study uppP2 inhibition, researchers should follow a systematic approach based on established experimental design principles :

  • Clearly Define the Research Question: Formulate a specific, measurable hypothesis about inhibitor effects on uppP2 activity or bacterial growth.

  • Identify Variables:

    • Independent variable: Inhibitor concentration

    • Dependent variable: Enzyme activity or bacterial growth

    • Control variables: pH, temperature, substrate concentration, buffer composition

  • Establish Controls: Include positive controls (known inhibitors), negative controls (vehicle only), and enzyme-free controls for background subtraction.

  • Design Logical Procedure:

    • Pre-incubate enzyme with inhibitor before adding substrate

    • Use a concentration range spanning at least 3 orders of magnitude

    • Perform multiple technical replicates (minimum n=3)

    • Include time-dependency measurements to distinguish between competitive and non-competitive inhibition

  • Data Collection and Analysis:

    • Record all measurements in consistent units

    • Construct dose-response curves and determine IC₅₀ values

    • Use appropriate statistical tests (ANOVA, t-tests) to evaluate significance

    • Consider enzyme kinetics models to determine inhibition mechanisms (competitive, non-competitive, uncompetitive)

The experimental workflow should logically progress from in vitro enzyme assays to cellular studies, establishing a clear connection between biochemical inhibition and physiological effects.

How can site-directed mutagenesis be utilized to study the catalytic mechanism of uppP2?

Site-directed mutagenesis represents a powerful approach for investigating the catalytic mechanism of R. rubrum uppP2. This methodology can identify essential residues involved in substrate binding and catalysis by systematically replacing them and measuring the impact on enzyme activity.

A comprehensive mutagenesis strategy should include:

  • Identification of Target Residues: Select conserved residues based on sequence alignment with homologous phosphatases and structural predictions. Focus on potential catalytic residues (Asp, Glu, His, Ser) and substrate-binding residues within transmembrane regions.

  • Mutagenesis Protocol:

    • Design primers containing the desired mutation with 15-20 flanking nucleotides on each side

    • Perform PCR-based mutagenesis using a high-fidelity polymerase

    • Verify mutations by DNA sequencing before expression

  • Functional Characterization:

    • Express and purify each mutant protein using identical conditions

    • Measure kinetic parameters (K<sub>m</sub>, k<sub>cat</sub>, k<sub>cat</sub>/K<sub>m</sub>) for all mutants

    • Compare thermal stability using differential scanning fluorimetry

    • Assess structural integrity using circular dichroism spectroscopy

  • Data Analysis and Interpretation:

    • Classify mutations based on their effects on catalysis (k<sub>cat</sub>) versus substrate binding (K<sub>m</sub>)

    • Create a functional map of the active site

    • Develop a mechanistic model explaining the catalytic process

For membrane proteins like uppP2, it's essential to verify that mutations don't disrupt membrane insertion or protein folding. Additionally, complementation assays in bacterial strains lacking endogenous uppP can confirm the functional significance of specific residues in vivo .

What approaches can address the challenges of working with membrane-bound enzymes like uppP2?

Working with membrane-bound enzymes presents unique challenges that require specialized approaches. For R. rubrum uppP2, researchers should consider:

  • Optimized Solubilization Strategies:

    • Test multiple detergents (DDM, CHAPS, LMNG) at different concentrations

    • Consider nanodiscs or styrene-maleic acid lipid particles (SMALPs) for maintaining a native-like lipid environment

    • Evaluate detergent-free extraction using amphipols for specific applications

  • Activity Preservation:

    • Incorporate appropriate lipids (phosphatidylglycerol, cardiolipin) during purification

    • Minimize exposure to harsh conditions (extreme pH, high temperatures)

    • Consider co-factor requirements that might be lost during purification

    • Test activity promptly after purification to establish baseline performance

  • Structural Studies Adaptations:

    • For crystallography, use lipidic cubic phase (LCP) methods

    • For cryo-EM, optimize grid preparation with specific detergents

    • Employ hydrogen-deuterium exchange mass spectrometry to probe conformational changes

  • Assay Modifications:

    • Develop cell-free assay systems using inverted membrane vesicles

    • Utilize fluorescently-labeled substrates for direct monitoring

    • Implement surface plasmon resonance for binding studies with detergent-compatible chips

When analyzing experimental data, account for the heterogeneous nature of membrane protein preparations by normalizing activity to the amount of correctly folded enzyme rather than total protein concentration .

How does the inhibition of uppP2 correlate with bacterial growth inhibition?

The correlation between uppP2 inhibition and bacterial growth inhibition involves complex relationships that must be carefully analyzed. Experimental data indicates that compounds inhibiting undecaprenyl diphosphatase enzymes show antimicrobial activity, but the correlation is not always linear. This complexity arises from factors including membrane permeability, compound stability, and potential off-target effects.

Analysis of inhibition data from various compounds reveals several patterns:

  • Direct Correlation Cases: Compounds like 11 show strong correlation between enzyme inhibition (IC₅₀ = 0.78 μM against SaUPPS) and growth inhibition (MIC = 0.082 μM against S. aureus), suggesting the compound effectively penetrates the membrane and specifically targets the enzyme .

  • Discrepancy Cases: Some compounds show strong enzyme inhibition but weak antimicrobial activity, suggesting limited cellular penetration or active efflux.

  • Lipophilicity Influence: Compounds with optimal logD values (typically 2-4) generally show better correlation between enzyme inhibition and antimicrobial activity, as seen in compounds 8-12 in the table from section 1.3 .

Researchers should employ statistical methods such as Pearson correlation coefficient or Spearman's rank correlation to quantify these relationships. Additionally, incorporating structural information and physicochemical properties into multivariate analysis can help identify the determinants of effective inhibition that translates to antimicrobial activity.

What methodological approaches are recommended for studying the role of uppP2 in bacitracin resistance?

To investigate the role of uppP2 in bacitracin resistance, researchers should implement a multi-faceted methodological approach:

  • Gene Knockout Studies:

    • Create a markerless deletion of the uppP2 gene in R. rubrum using homologous recombination

    • Verify deletion using PCR and Southern blot analysis

    • Assess the mutant's sensitivity to bacitracin through minimum inhibitory concentration (MIC) determinations

    • Complement the mutant with plasmid-expressed uppP2 to confirm phenotype specificity

  • Overexpression Analysis:

    • Generate strains overexpressing uppP2 under control of inducible promoters

    • Quantify expression levels using qRT-PCR and western blotting

    • Measure bacitracin resistance relative to expression levels

    • Determine if overexpression affects other cellular processes

  • Biochemical Characterization:

    • Purify recombinant uppP2 and determine kinetic parameters in the presence of varying bacitracin concentrations

    • Investigate direct interactions between bacitracin and uppP2 using surface plasmon resonance or isothermal titration calorimetry

    • Analyze whether bacitracin competitively inhibits the enzyme or affects it through another mechanism

  • Structural Biology Approaches:

    • Obtain structural information about uppP2 through X-ray crystallography or cryo-EM

    • Use molecular docking to predict bacitracin binding sites

    • Perform site-directed mutagenesis of predicted binding sites to validate their importance

When analyzing data, researchers should consider constructing mathematical models that account for the dynamic relationship between uppP2 activity, UPP/UP ratios, and bacitracin sensitivity .

How can isotopic labeling techniques be applied to study uppP2 function in bacterial cell wall biosynthesis?

Isotopic labeling techniques provide powerful tools for tracking metabolic pathways and enzyme functions in vivo. For studying uppP2's role in bacterial cell wall biosynthesis, researchers can implement:

When analyzing data from isotopic labeling experiments, researchers should apply appropriate mathematical models that account for isotope dilution, exchange rates, and potential metabolic channeling effects. Statistical analysis should include propagation of error calculations to ensure accurate interpretation of results .

What are the common challenges in expressing active recombinant uppP2 and how can they be overcome?

Expressing functional membrane proteins like uppP2 presents several challenges that researchers frequently encounter. Here are the most common issues and recommended solutions:

  • Protein Misfolding and Aggregation:

    • Challenge: Overexpression often leads to inclusion body formation

    • Solutions:

      • Reduce expression temperature to 16-20°C

      • Decrease inducer concentration (0.1-0.2 mM IPTG)

      • Try specialized E. coli strains like C41(DE3) or C43(DE3) designed for membrane protein expression

      • Co-express with molecular chaperones (GroEL/GroES)

      • Use fusion partners like MBP or SUMO to enhance solubility

  • Low Expression Yields:

    • Challenge: Membrane proteins typically express at lower levels than soluble proteins

    • Solutions:

      • Optimize codon usage for E. coli

      • Use strong promoters with tight regulation (T7-lac)

      • Extend expression time (24-48 hours) at reduced temperatures

      • Scale up culture volume and optimize media composition (try auto-induction media)

      • Consider alternative expression hosts like Pichia pastoris

  • Inefficient Membrane Insertion:

    • Challenge: Recombinant uppP2 may not properly integrate into membranes

    • Solutions:

      • Co-express with membrane integration factors

      • Test different signal sequences or membrane-targeting sequences

      • Employ in vitro translation systems with supplied membranes

  • Protein Instability During Purification:

    • Challenge: Activity loss during extraction and purification

    • Solutions:

      • Screen multiple detergents systematically

      • Include stabilizing agents (glycerol, specific lipids)

      • Add protease inhibitors throughout purification

      • Purify at 4°C and minimize time between steps

      • Consider native purification techniques like SMALPs

Documentation of optimization efforts should follow scientific methodology with systematic variation of parameters and quantifiable outcomes to guide future expression attempts.

How can researchers validate that purified recombinant uppP2 maintains its native structure and function?

Validating the native structure and function of purified recombinant uppP2 requires multiple complementary approaches:

  • Functional Validation:

    • Enzymatic activity assays comparing specific activity to predicted or previously reported values

    • Substrate specificity testing with various potential substrates

    • Kinetic parameter determination (K<sub>m</sub>, V<sub>max</sub>, k<sub>cat</sub>) and comparison with native enzyme if available

    • Inhibition profile using known inhibitors of undecaprenyl diphosphatases

  • Structural Validation:

    • Circular dichroism (CD) spectroscopy to verify secondary structure composition

    • Size-exclusion chromatography coupled with multi-angle light scattering (SEC-MALS) to confirm oligomeric state

    • Limited proteolysis to assess proper folding (correctly folded proteins show characteristic digestion patterns)

    • Thermal shift assays to determine stability and proper folding

    • Negative-stain electron microscopy to verify particle homogeneity

  • In vivo Complementation:

    • Test whether the recombinant protein can rescue phenotypes in bacterial strains with uppP mutations

    • Measure bacitracin sensitivity restoration in complemented strains

  • Comparative Analysis:

    • Compare properties with those of similar enzymes from other bacterial species

    • Verify that any modifications (His-tags, fusion partners) don't impact function through parallel testing of different constructs

When analyzing validation data, researchers should establish clear criteria for considering the protein "native-like" based on quantitative thresholds for activity, stability, and structural parameters. This approach provides a more objective assessment than qualitative comparisons .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.