Recombinant Rhodospirillum rubrum UPF0761 membrane protein Rru_A2625 (Rru_A2625)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional fees.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Rru_A2625; UPF0761 membrane protein Rru_A2625
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-440
Protein Length
full length protein
Species
Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1)
Target Names
Rru_A2625
Target Protein Sequence
MVDDENRRRGLLGRRSHARSWLPVKPRRILATAGSFTILVLRALITHDIPRLAASLAYTS LLALVPLIAIALAILAAFPGFGDERERMVAWIIETFVPYRRTEILDQVEHFVGAAAGLTA LGVAGLTLTAIILLLTIESSLNAIFRVEKSRHPLARLLVYWSVLTGGPLLMGLSFSLSSY LVAIRHLVGTDVMSPFDALTPTLGPPLLSLTAMTLLYMLVPNRPVPLFHALAGALVATLA SALLRSAFLMVITRGLSYETLYGALAALPAFLVWMYLSWAVVLMGAVTAAEIPNWKMARR LTRAGQDERAARLRIAVEIMVAAARAYGEGQGDGASRRALSALTATPDRRQAGVLRDLDK AGLLIRDEDGAVLPGRDPRRITLAEILHALTLAPPTGTVGGPGWPDLLRHALETAGGDYD RALGLSLDALVQAEPLGARI
Uniprot No.

Target Background

Database Links
Protein Families
UPF0761 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What approaches are recommended for expressing recombinant membrane proteins like Rru_A2625?

Expression of membrane proteins presents unique challenges compared to soluble proteins. For Rru_A2625, consider the following methodological approach:

  • Select an appropriate expression system: For bacterial membrane proteins, E. coli is often the first choice, but for complex membrane proteins, consider Rhodospirillum rubrum itself as an expression host to ensure proper folding.

  • Optimize culture conditions: For photosynthetic proteins from R. rubrum, the presence/absence of light during cultivation significantly impacts expression. Consider using "obligate phototrophy to select for plasmid maintenance" when culturing complemented strains in light conditions, as tetracycline can be photolabile .

  • Design appropriate fusion tags: N-terminal or C-terminal affinity tags (His6, GST, MBP) can facilitate purification while minimizing interference with membrane insertion.

  • Evaluate membrane fractionation methods: Techniques such as ultracentrifugation or detergent-based extraction are critical for isolating membrane proteins like Rru_A2625.

What experimental design considerations are crucial when studying Rru_A2625 function?

When designing experiments to study Rru_A2625:

  • Define your variables clearly: Identify independent variables (e.g., expression conditions, mutations introduced) and dependent variables (e.g., protein activity, membrane localization) .

  • Develop a specific, testable hypothesis about Rru_A2625 function based on structural predictions or homology modeling .

  • Design appropriate controls: Include wild-type Rru_A2625, empty vector controls, and possibly related membrane proteins from R. rubrum as comparisons.

  • Plan for replication: A minimum of three biological replicates is recommended to ensure statistical validity of your findings .

  • Consider randomization: When testing multiple conditions or treatments, randomize your experimental order to minimize systematic errors .

Experimental ApproachKey Variables to ControlTypical Measurements
In vitro activity assayspH, temperature, substrate concentrationBinding affinity, enzyme kinetics
Localization studiesCell fractionation methods, antibody specificityMembrane association, protein distribution
Mutational analysisExpression levels, protein stabilityStructure-function relationships

How should I validate the proper expression and folding of recombinant Rru_A2625?

Validating proper expression and folding of membrane proteins requires multiple complementary approaches:

  • Immunoblotting: Use anti-tag antibodies or develop Rru_A2625-specific antibodies to confirm expression at the expected molecular weight.

  • Membrane fractionation: Confirm localization to the membrane fraction using ultracentrifugation techniques, similar to approaches used for other membrane proteins .

  • Circular dichroism (CD) spectroscopy: Evaluate secondary structure content to confirm proper folding of the purified protein.

  • Functional assays: Develop specific assays based on predicted function or homology to other characterized membrane proteins.

  • Mass spectrometry: Confirm protein identity and evaluate post-translational modifications that might affect function.

What methodologies are recommended for site-directed mutagenesis studies of Rru_A2625?

For site-directed mutagenesis studies:

  • Identify critical residues: Use sequence alignments with homologous proteins and structural prediction tools to identify conserved or functionally important residues.

  • Design mutagenesis strategy: For bacterial proteins like Rru_A2625, PCR-based methods such as QuikChange or overlap extension PCR are effective. As described for other recombinant systems, "site-directed mutagenesis of an infectious cDNA virus clone" can be adapted for your specific system .

  • Confirm mutations: Verify mutations by DNA sequencing before expression.

  • Express and characterize mutants: Compare expression levels, localization, and function of mutants with wild-type Rru_A2625. Consider the methods used for "biochemical characterization of the MAR hydrolase activity of nsP3 MD mutants" as a model for your approach.

  • Analyze structure-function relationships: Correlate the effects of mutations with structural predictions to develop a functional model.

How can I design experiments to characterize protein-protein interactions involving Rru_A2625?

To characterize protein-protein interactions:

  • Co-immunoprecipitation (Co-IP): Use antibodies against Rru_A2625 or its fusion tag to pull down potential interaction partners.

  • Bacterial two-hybrid assays: Adapt bacterial two-hybrid systems to identify interacting proteins in vivo.

  • Crosslinking studies: Use chemical crosslinkers to stabilize transient interactions, followed by mass spectrometry identification.

  • Surface plasmon resonance (SPR): For purified proteins, quantify binding kinetics and affinity.

  • Reversal design approach: Implement an A-B-A-B experimental design where A represents conditions without potential interacting partners and B represents conditions with them. This approach allows for multiple replications of treatment effects (A1 versus B1, B1 versus A2, A2 versus B2) to demonstrate experimental control .

What strategies should I employ for resolving contradictory data regarding Rru_A2625 function?

When facing contradictory results:

  • Secondary data analysis (SDA): Review all experimental conditions and raw data. As noted in research literature, "SDA researchers must be knowledgeable about their research area to identify datasets that are a good fit" .

  • Evaluate experimental variables: Identify differences in expression systems, purification methods, or assay conditions that might explain contradictory results.

  • Assess data quality: Examine statistical power, replication levels, and experimental controls in contradictory studies.

  • Design reconciliation experiments: Develop experiments specifically designed to address the contradictions:

    • Use multiple approaches to measure the same parameter

    • Systematically vary conditions to identify factors causing discrepancies

    • Consider independent validation by collaborators

  • Meta-analysis approach: When multiple datasets exist, perform a meta-analysis to identify patterns and factors contributing to contradictory results .

What are the advanced approaches for studying membrane topology and structure of Rru_A2625?

To determine membrane topology and structure:

  • Protease accessibility assays: Use limited proteolysis followed by mass spectrometry to identify exposed regions.

  • Cysteine scanning mutagenesis: Introduce cysteine residues at various positions and probe accessibility with thiol-reactive reagents.

  • Fluorescence techniques: Use fluorescent probes or GFP fusions to monitor localization and orientation.

  • Structural biology approaches: Consider techniques like:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy (cryo-EM)

    • Nuclear magnetic resonance (NMR) for specific domains

  • Computational modeling: Use the Orientations of Proteins in Membranes (OPM) database classification system to predict membrane protein orientation based on "4 levels: 'Type', 'Class', 'Superfamily', and 'Family'" .

How should I design a comprehensive functional characterization study for Rru_A2625?

A comprehensive functional characterization requires:

  • Multi-phase experimental approach:

    • Phase 1: Expression optimization and basic characterization

    • Phase 2: Detailed biochemical/biophysical characterization

    • Phase 3: Functional assays based on predicted roles

    • Phase 4: In vivo studies to verify physiological relevance

  • Factorial experimental design: Test multiple variables simultaneously to identify interactions. "Design and Analysis of Experiments provides a rigorous introduction to product and process design improvement through quality and performance optimization" .

  • Define clear endpoints: Establish quantifiable metrics for each aspect of characterization.

  • Statistical analysis plan: Determine appropriate statistical tests based on data distribution and experimental design.

  • Timeline consideration: Allow sufficient time for optimization and troubleshooting at each phase.

What methodologies are recommended for studying oxidative stress responses involving membrane proteins like Rru_A2625?

To study potential oxidative stress-related functions:

  • Measure antioxidant enzyme activities: Evaluate activities of enzymes like SOD, GSH-Px, GST, and CAT in systems with and without functional Rru_A2625 .

  • Monitor oxidative stress markers: Quantify levels of MDA and 8-OHdG as indicators of oxidative damage .

  • Gene expression analysis: Use real-time PCR to detect mRNA levels of stress-responsive genes like SOD, GSH-Px, and HO-1 .

  • Signaling pathway analysis: Investigate potential involvement in stress-responsive pathways like Nrf2/ARE using western blotting to measure pathway activation .

  • Functional recovery assays: If Rru_A2625 has protective functions, design experiments to measure recovery from induced oxidative stress.

How can I implement single-case experimental designs (SCEDs) to study Rru_A2625 function under varying conditions?

SCEDs can be adapted to study Rru_A2625:

  • Reversal design approach (A-B-A-B):

    • A: Baseline conditions without stress/stimuli

    • B: Experimental conditions with stress/stimuli

    • This design allows demonstration of experimental control through multiple replications of treatment effects .

  • Multiple baseline design: Introduce treatments at different times across multiple experimental setups.

  • Combined designs: Use both reversal and multiple baseline approaches for robust experimental control.

  • Data collection considerations: "Stability refers to the degree of variability in the data path over time (e.g., data points must fall within a 15% range of the median for a condition)" .

  • Phase length flexibility: Ensure each experimental phase is long enough to establish stability, with "a minimum of 5 data points per phase" .

What are the recommended approaches for purifying recombinant Rru_A2625 while maintaining native conformation?

For optimal purification while preserving native conformation:

  • Detergent screening: Test multiple detergents (e.g., DDM, LDAO, OG) to identify optimal solubilization conditions.

  • Stabilization strategies:

    • Add specific lipids during purification

    • Use glycerol or other stabilizing agents

    • Consider nanodiscs or amphipols for detergent-free environments

  • Purification workflow:

    • Membrane isolation by ultracentrifugation

    • Solubilization with selected detergent

    • Affinity chromatography based on fusion tag

    • Size exclusion chromatography for final polishing

  • Quality control metrics: Implement rigorous criteria to assess purity, homogeneity, and stability:

    • SDS-PAGE and western blotting

    • Dynamic light scattering

    • Thermal stability assays

  • Storage optimization: Determine conditions (temperature, buffer components, additives) that maintain stability during storage.

How can I adapt RNA polymerase interaction studies for investigating Rru_A2625's potential regulatory functions?

If investigating potential interactions with transcriptional machinery:

  • In vitro transcription experiments: Adapt methodologies used for "characterizing the mechanism of nucleotide addition used by bacterial RNAPs" .

  • Comparative binding studies: Investigate if "Rru_A2625 uniquely binds a nucleotide analog with significantly higher affinity than canonical nucleotides" .

  • Elongation complex formation: Analyze potential effects on transcription elongation using techniques from bacterial RNA polymerase studies.

  • Inhibitor sensitivity testing: Evaluate if Rru_A2625 affects sensitivity to RNA polymerase inhibitors like rifampicin.

  • Protein-protein interaction analysis: Use pull-down assays to investigate direct interaction with RNA polymerase components.

This approach is particularly valuable if Rru_A2625 is suspected to have regulatory roles in transcription, similar to other bacterial membrane proteins that participate in signal transduction pathways affecting gene expression.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.