Recombinant Rhodothermus marinus ATP-dependent zinc metalloprotease FtsH (ftsH)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is requested. Dry ice shipping requires prior communication and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided as a guideline for your reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion in the production process.
Synonyms
ftsH; Rmar_0836; ATP-dependent zinc metalloprotease FtsH
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-697
Protein Length
full length protein
Species
Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) (Rhodothermus obamensis)
Target Names
ftsH
Target Protein Sequence
MSQNERDSLELERKNTPPDGPRLPERRPRFSVWIYLAIFLALLVHFFLFWTGTDTSTIEY SQFLEYVEKGYVERVEIVNDTKVQGRFTEAAVREGLVSVPVRQTDLLRGAQTPELIRRFT TTKPADHDLTSFLLAYNERARAEGRPTVQFTARIEENWFGGLLTWIFPLILIVALWVFLL RRMSPSSQVLNIGKNRAILYDAMGDHRVTFKDVAGLDEAKEEVAEIVEFLKNPKKFTRLG GKLPKGVLLVGPPGTGKTLLAKAVAGEAGVPFFSISGSDFVEMFVGVGAARVRDLFRQAK EKAPCIIFIDEIDAIGRSRGRGIMMGANDERENTLNQLLVEMDGFNTDKGVIIMAATNRP DVLDPALLRPGRFDRQILIDKPDRRERLEIFKVHTRDLILGDDVDLEVLAGQTPGFAGAE IANVCNEAALLAARKGKEAVEMEDFEQAIDRVIAGLEKKNKIISPEEREIVAYHEAGHAI VGWFLRYTDPVVKVSIVPRGLAALGYAQYLPEERYLYTKEALLDRMTMAIGGRVAEELVF GRISTGAQNDLERITRMAYAMVVDYGMSERVGYVSFNLSGQYGEQAFFDKPYSEETARLI DEEVRRIINEVRERARRILEEKRDKLEALARRLLEKEVLGPRDLVEILGPRPYGDYPSPN GKDVEELKDLQKGEPTSSSAVEAPAPQTERPESSSAP
Uniprot No.

Target Background

Function
This recombinant Rhodothermus marinus ATP-dependent zinc metalloprotease FtsH functions as a processive, ATP-dependent zinc metallopeptidase, targeting both cytoplasmic and membrane proteins. It plays a crucial role in the quality control of integral membrane proteins.
Database Links
Protein Families
AAA ATPase family; Peptidase M41 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein; Cytoplasmic side.

Q&A

What is Rhodothermus marinus FtsH and what are its key characteristics?

Rhodothermus marinus FtsH belongs to the universal family of FtsH proteases, which are membrane-anchored, ATP-dependent zinc metalloproteases. These proteases are present in prokaryotes and the organelles of eukaryotic cells, including mitochondria and chloroplasts . R. marinus is a thermophilic bacterium, making its FtsH protease particularly interesting for its thermostable properties.

The FtsH protease functions as a quality control enzyme that degrades misfolded or damaged proteins, particularly membrane proteins. Like other FtsH proteases, the R. marinus variant likely forms hexameric complexes that are essential for its proteolytic activity. These complexes conduct ATP-dependent proteolysis by unfolding and translocating target substrates through the central pore of the ATPase complex to the protease domain for degradation .

Based on studies of FtsH from other organisms, R. marinus FtsH likely contains several key structural domains: transmembrane domains that anchor the protein to the membrane, an ATPase domain that provides energy through ATP hydrolysis, and a proteolytic domain containing a zinc-binding motif essential for catalysis.

How can Rhodothermus marinus FtsH be recombinantly expressed and purified?

The expression and purification of recombinant R. marinus FtsH can be approached using strategies similar to those employed for other FtsH proteases. For example, with Plasmodium falciparum FtsH1, researchers have successfully used E. coli expression systems with specific modifications to accommodate the high A+T content of the gene .

A methodological approach would include:

  • Gene optimization: Codon optimization for E. coli expression is often necessary, especially for genes from organisms with different codon usage preferences.

  • Expression system selection: For thermophilic proteins like R. marinus FtsH, E. coli strains designed for expression of toxic or membrane proteins, such as C41(DE3), are recommended . Co-transformation with the RIG plasmid can enhance expression of A+T-rich genes .

  • Expression conditions: Lower temperatures (22-30°C) after induction and extended expression times (16 hours) can improve the yield of properly folded protein . For R. marinus proteins, which are naturally thermostable, higher expression temperatures might be tolerated.

  • Protein purification: Affinity chromatography using fusion tags (such as GST or His-tag) followed by size exclusion chromatography is typically effective. For membrane proteins like FtsH, inclusion of appropriate detergents in the purification buffers is critical for maintaining protein solubility and native structure.

  • Activity verification: After purification, the zinc- and ATP-dependent protease activity should be verified using model substrates such as α-casein, which is often used for FtsH activity assays .

What assays can be used to measure R. marinus FtsH activity?

The proteolytic activity of R. marinus FtsH can be assessed using several established methodologies based on approaches used for other FtsH proteases:

  • Casein degradation assay: α-casein serves as an excellent substrate for FtsH proteases due to its loosely folded structure. Time-dependent proteolysis can be monitored by SDS-PAGE analysis of reaction mixtures containing the purified FtsH, casein, ATP, and appropriate buffer components including zinc ions .

  • Fluorescence-based assays: Fluorogenic peptide substrates can be used to continuously monitor FtsH activity. Cleavage of these substrates releases a fluorophore, allowing real-time measurement of proteolytic activity.

  • ATP binding and hydrolysis assays: Since FtsH proteases require ATP, monitoring ATP binding through intrinsic tryptophan fluorescence quenching can provide insights into the functional state of the enzyme . ATP hydrolysis can be measured using colorimetric assays such as the malachite green assay or EnzChek.

  • Metal dependence verification: The zinc dependence of R. marinus FtsH can be confirmed by observing reduced proteolytic activity in the presence of metal chelators like EDTA, and restoration of activity upon addition of zinc ions .

For R. marinus FtsH specifically, these assays should be conducted at elevated temperatures (50-65°C) to reflect the thermophilic nature of the organism and to assess the thermostability of the recombinant enzyme.

How does the hexameric complex formation impact R. marinus FtsH activity?

The FtsH family of proteases functions as hexameric complexes, with the formation of these oligomeric structures being essential for their proteolytic activity . For R. marinus FtsH, investigating complex formation would require a multifaceted approach:

  • Native PAGE and size exclusion chromatography can be used to identify the oligomeric state of purified R. marinus FtsH under various conditions. Cross-linking studies with agents such as glutaraldehyde can capture transient interactions between monomers.

  • Analytical ultracentrifugation provides precise determination of the molecular weight and shape of the complex in solution. This technique can reveal whether the protein exists in multiple oligomeric states in equilibrium.

  • Cryo-electron microscopy (cryo-EM) offers the potential to visualize the three-dimensional structure of the hexameric complex. This approach has been successful for other FtsH proteases, revealing the arrangement of protomers and the central pore critical for substrate translocation .

  • Mutagenesis studies targeting residues at the interfaces between protomers can identify key interactions necessary for complex stability and function. By correlating complex formation with proteolytic activity, researchers can establish the relationship between oligomerization and catalysis.

  • For thermophilic organisms like R. marinus, it would be particularly informative to investigate how temperature affects complex formation and stability, as the hexameric structure might exhibit unique thermal adaptation mechanisms compared to mesophilic counterparts.

The association between protomers in FtsH complexes creates the central pore through which substrates are translocated to the proteolytic chamber. Understanding this architecture is crucial for elucidating the mechanism of substrate processing by R. marinus FtsH.

What is the molecular mechanism of ATP utilization in R. marinus FtsH-mediated proteolysis?

The ATP-dependent nature of FtsH proteolysis is a defining characteristic of these enzymes. For R. marinus FtsH, elucidating the ATP utilization mechanism would involve:

  • Site-directed mutagenesis of conserved residues in the Walker A and B motifs of the ATPase domain to determine their roles in ATP binding and hydrolysis. These mutants can be characterized for their impact on proteolytic activity.

  • ATP binding studies using techniques such as isothermal titration calorimetry (ITC) or intrinsic tryptophan fluorescence quenching to determine binding affinities and stoichiometry.

  • Pre-steady-state kinetic analysis to delineate the steps in the catalytic cycle where ATP binding and hydrolysis occur. This can reveal whether ATP hydrolysis is coupled to substrate unfolding, translocation, or both.

  • Assessment of ATP consumption per peptide bond cleaved. Theoretical considerations suggest a minimum requirement of 6 ATP molecules per cleavage event, while experimental data for some FtsH proteases indicate consumption of approximately 8 ATP molecules per peptide cleavage reaction .

  • Investigation of conformational changes induced by ATP binding and hydrolysis using techniques such as hydrogen-deuterium exchange mass spectrometry (HDX-MS) or fluorescence resonance energy transfer (FRET) with strategically placed fluorophores.

In the thermophilic R. marinus, the ATP-dependent conformational changes might be uniquely adapted to function at elevated temperatures, potentially with different energetic requirements compared to mesophilic FtsH proteases.

How does the zinc-binding site contribute to the catalytic mechanism of R. marinus FtsH?

The zinc ion in the active site of FtsH proteases is essential for their proteolytic activity, as evidenced by the inhibition of activity in the presence of metal chelators like EDTA . To investigate the zinc-binding site in R. marinus FtsH:

  • Sequence analysis to identify conserved zinc-binding motifs, typically HEXXH in metalloproteases, where the two histidines coordinate the zinc ion and the glutamate participates in catalysis.

  • Site-directed mutagenesis of the putative zinc-binding residues followed by proteolytic activity assays to confirm their role in catalysis.

  • Metal content analysis using techniques such as inductively coupled plasma mass spectrometry (ICP-MS) to quantify zinc binding to wild-type and mutant proteins.

  • X-ray absorption spectroscopy (XAS) to determine the coordination geometry of the zinc ion in the active site.

  • pH-dependent activity studies to identify the optimal pH for catalysis and establish the protonation states of key residues involved in zinc coordination and substrate hydrolysis.

For R. marinus FtsH, it would be particularly interesting to investigate whether the thermophilic nature of the enzyme affects the zinc-binding site structure or the pKa values of zinc-coordinating residues, which could influence catalytic efficiency at elevated temperatures.

What approaches can be used to identify and characterize natural substrates of R. marinus FtsH?

Identifying the natural substrates of R. marinus FtsH is crucial for understanding its biological role. Several complementary approaches can be employed:

  • Proteomic analysis: Compare the proteome of wild-type R. marinus with an FtsH-deficient strain (created using the chromosomal engineering approaches described for R. marinus ) to identify proteins that accumulate in the absence of FtsH activity.

  • Co-immunoprecipitation: Use antibodies against FtsH to pull down potential substrate proteins that transiently interact with the protease, followed by mass spectrometry identification.

  • Substrate trapping: Engineer catalytically inactive FtsH variants (e.g., by mutating the zinc-binding site) that can bind but not degrade substrates, allowing for more stable interactions with target proteins.

  • In vitro degradation assays: Test candidate substrate proteins identified through the above approaches for degradation by purified R. marinus FtsH in reconstituted systems.

  • Bioinformatic prediction: Analyze protein sequences for features that might make them susceptible to FtsH degradation, such as exposed hydrophobic patches or specific degron sequences.

Given the role of FtsH in membrane protein quality control, particular attention should be paid to membrane-associated proteins involved in energy metabolism, as FtsH has been implicated in maintaining photosynthesis and respiration in various organisms .

How can genome engineering be used to study R. marinus FtsH function in vivo?

Genetic manipulation of R. marinus to study FtsH function can be approached using established chromosomal engineering methods for this thermophile:

  • Marker-based selection strategies: Utilizing selective markers such as trpB (tryptophan prototrophy) and purA (adenine prototrophy) that have been validated for R. marinus . The double deletant strain SB-62 (ΔtrpB ΔpurA) provides a robust background for further genetic manipulations.

  • Linear DNA transformation: R. marinus has been shown to efficiently incorporate linear DNA molecules through double-crossover recombination, allowing for targeted gene replacements with minimal unintended chromosomal integration .

  • Creating FtsH mutants: The ftsH gene in R. marinus can be targeted for deletion, modification, or replacement using homologous recombination with linear molecules containing flanking homologous sequences (700-800 bp on each side has been effective) .

  • Phenotypic analysis: FtsH-deficient strains can be characterized for growth defects, stress sensitivity, and accumulation of potential substrate proteins.

  • Complementation studies: Reintroducing wild-type or mutant versions of the ftsH gene to assess functional restoration and the effects of specific mutations.

The thermophilic nature of R. marinus presents unique opportunities to study the role of FtsH in adaptation to high temperatures, which could reveal novel aspects of protease function not observable in mesophilic systems.

What structural biology techniques are most effective for studying R. marinus FtsH?

Given the complex architecture of FtsH proteases, a combination of structural biology approaches is necessary for comprehensive characterization:

How can protein engineering be applied to enhance the utility of R. marinus FtsH for research and biotechnological applications?

The thermostable nature of R. marinus FtsH makes it an attractive candidate for protein engineering to develop enhanced variants for research and biotechnological applications:

  • Domain swapping: Exchanging domains between R. marinus FtsH and FtsH from other organisms to create chimeric proteins with novel properties or substrate specificities.

  • Rational design: Using structural information and sequence conservation analysis to identify residues for mutagenesis that might enhance specific properties such as:

    • Increased thermostability for industrial applications

    • Modified substrate specificity for targeted proteolysis

    • Enhanced solubility for easier handling in laboratory settings

    • Altered ATP dependence for more efficient energy utilization

  • Directed evolution: Implementing iterative rounds of mutagenesis and selection to evolve FtsH variants with desired properties such as increased catalytic efficiency or broader substrate range.

  • Solubilization strategies: Engineering variants with reduced hydrophobicity in the transmembrane regions or creating soluble versions by removing the transmembrane domains while maintaining hexamer formation and catalytic activity.

  • Tags and fusion proteins: Developing FtsH fusion constructs with affinity tags, fluorescent proteins, or other functional domains for specific applications in protein purification, localization studies, or biosensor development.

The inherent stability of proteins from thermophilic organisms like R. marinus provides an excellent starting point for engineering efforts, as these proteins often tolerate substantial modifications without losing their core structural integrity.

What are the challenges in expressing full-length R. marinus FtsH and how can they be overcome?

Expression of full-length membrane proteins like R. marinus FtsH presents several challenges that can be addressed with specific strategies:

  • Toxicity to expression hosts: The membrane-disrupting potential of overexpressed FtsH can be mitigated by using specialized E. coli strains like C41(DE3) that are designed for toxic protein expression . Tight regulation of expression using inducible promoters with minimal leaky expression is also beneficial.

  • Inclusion body formation: Lower induction temperatures (22-30°C), reduced inducer concentrations, and extended expression times can promote proper folding and membrane insertion . For thermophilic proteins, expression at higher temperatures within the tolerance range of the host might improve folding.

  • Codon usage discrepancies: Codon optimization of the R. marinus ftsH gene for the expression host can enhance translation efficiency. Alternatively, co-expression with rare tRNA genes (e.g., using the RIG plasmid for A+T-rich genes) can help overcome codon bias issues .

  • Membrane insertion: Expression systems with efficient membrane protein insertion machinery, such as those derived from the bacterial Sec translocon, can facilitate proper localization of FtsH.

  • Protein truncation: If expression of the full-length protein remains challenging, expressing functional fragments (such as the ATPase and protease domains without the transmembrane regions) can be a viable alternative for biochemical and structural studies .

The sequence of the R. marinus ftsH gene may need to be modified to optimize expression while maintaining the thermophilic and catalytic properties that make this enzyme interesting for research.

How can the thermostability of R. marinus FtsH be accurately measured and characterized?

The thermostability of R. marinus FtsH is a key property that distinguishes it from mesophilic homologs and can be characterized using several complementary approaches:

  • Thermal shift assays: Differential scanning fluorimetry (DSF) using fluorescent dyes like SYPRO Orange that bind to hydrophobic regions exposed upon thermal unfolding can determine the melting temperature (Tm) of the protein.

  • Circular dichroism (CD) spectroscopy: Monitoring changes in secondary structure as a function of temperature provides insights into the thermal unfolding process and potential intermediate states.

  • Activity-based thermal stability: Measuring proteolytic activity after pre-incubation at various temperatures for defined time periods can establish the temperature range where the enzyme remains functional.

  • Differential scanning calorimetry (DSC): Provides thermodynamic parameters associated with protein unfolding, including the enthalpy change (ΔH) and the heat capacity change (ΔCp).

  • Limited proteolysis: Comparing the susceptibility of the protein to proteolytic digestion at different temperatures can reveal regions of increased flexibility or local unfolding.

  • Molecular dynamics simulations: Computational approaches can provide atomic-level insights into the structural basis of thermostability, identifying key interactions that maintain the folded state at elevated temperatures.

For R. marinus FtsH, these measurements should be conducted both in detergent micelles and in reconstituted membrane environments to account for the stabilizing effect of the lipid bilayer on the membrane-embedded regions.

How should kinetic data for R. marinus FtsH be analyzed to extract meaningful mechanistic information?

Kinetic analysis of R. marinus FtsH requires careful consideration of its dual ATPase and protease activities, as well as its oligomeric nature:

  • Steady-state kinetics: Determining Michaelis-Menten parameters (Km, kcat) for both ATP hydrolysis and proteolytic activities under varying conditions can reveal how these two functions are coupled. The following table illustrates how these parameters might be analyzed:

ParameterWild-type FtsHATPase MutantProtease MutantSignificance
Km(ATP)x μMIncreasedSimilar to WTATP binding affinity
kcat(ATP)y min^-1DecreasedSimilar to WTATP hydrolysis rate
Km(substrate)z μMSimilar to WTIncreasedSubstrate binding affinity
kcat(proteolysis)w min^-1DecreasedNegligibleProteolysis rate
  • Cooperative effects: Since FtsH functions as a hexamer, analyzing the Hill coefficient for both ATP binding and substrate degradation can reveal cooperative interactions between protomers.

  • ATP:peptide bond cleavage ratio: Determining the number of ATP molecules consumed per peptide bond cleaved provides insights into the energetic efficiency of the process. Theoretical considerations suggest a minimum of 6 ATP molecules per cleavage event, while experimental data for some FtsH proteases indicate consumption of approximately 8 ATP molecules per peptide cleavage reaction .

  • Temperature effects: For the thermophilic R. marinus FtsH, analyzing the temperature dependence of kinetic parameters is particularly important, as the optimal temperature for activity may differ from that of mesophilic FtsH proteases.

  • Single-molecule studies: Advanced techniques such as single-molecule FRET or optical tweezers can provide mechanistic insights into substrate translocation and processing that are not accessible through bulk measurements.

When interpreting kinetic data, it's important to consider that the membrane environment can significantly influence enzyme behavior, so measurements in detergent micelles should be complemented with studies in reconstituted membranes when possible.

What bioinformatic approaches can provide insights into R. marinus FtsH function and evolution?

Bioinformatic analysis can reveal important aspects of R. marinus FtsH structure, function, and evolutionary relationships:

  • Sequence alignment and conservation analysis: Identifying conserved residues across FtsH homologs can pinpoint functionally important regions. Special attention should be paid to residues that might contribute to thermostability in R. marinus compared to mesophilic homologs.

  • Structural modeling: Homology modeling based on available structures of FtsH from other organisms can provide insights into the three-dimensional arrangement of domains and the potential structural basis for thermostability.

  • Molecular dynamics simulations: Computational simulations can reveal dynamics and stability at different temperatures, highlighting adaptations that might enable function in thermophilic conditions.

  • Phylogenetic analysis: Constructing evolutionary trees of FtsH proteases can place R. marinus FtsH in its evolutionary context and potentially identify adaptive changes associated with thermophily.

  • Genomic context analysis: Examining the genomic neighborhood of the ftsH gene in R. marinus can reveal functional associations with other genes and potential regulatory mechanisms.

  • Substrate prediction: Computational approaches can identify potential R. marinus FtsH substrates based on features such as exposed hydrophobic patches, disordered regions, or specific sequence motifs recognized by the protease.

These bioinformatic approaches can guide experimental design and help interpret experimental results in the broader context of FtsH function and evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.