Recombinant Rhodothermus marinus Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery estimates.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. You may use this as a reference.
Shelf Life
The shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid formulations have a shelf life of 6 months at -20°C/-80°C. Lyophilized formulations have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
secD; Rmar_1455; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-622
Protein Length
full length protein
Species
Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) (Rhodothermus obamensis)
Target Names
secD
Target Protein Sequence
MKRNGFKIGVTLALLLLCGYYLYPTVRYALLQRKLNRMSEEERAAFIEANYGTIQSLRER ALKLGLDLQGGMHVTLEVRVDALIRELATDVDETFEEVLAAARERARSGDVSLIDAFVEE FERRDPNARLSRYFRNPDAGITRRSSNEEVAAYLRQQAEEAVNRAIEIIRDRVDRYGVTE PVIQKQGTRRIVVELPGVDDPERVRRLLRGTARLEFRLMADPQLLQAALQDIIAYYEPDT TAASETSAVTDTATADTSLAALLGEQPSPERPRNPLLAVMQPVGQGVVFGIVAGPDTAQV NRLLRNPEVQALLPSGIELLYTANPVGTDEQGRPLYYLLGVRKEVELTGEVITDARVEFD ELNRPQVSMTMNSEGARIWARLTGANVGKHIAIVLDNVVYSYPVVNERIPSGRSSITGLD SREEAQDIVTVLKSGALPAPVDIIEERTVGPSLGEASIRAGLRSVLTGLLLVALFMIFYY RTGGMIADLALVLNIIFILGILAAFNATLTLPGIAGIVLTIGMAVDANVLIFERIREEQA TGKTLRAAIDLGYSKAFSAIFDANITTFFTAAILYSFGVGPIQGFAVTLMAGIAASLFSA IVITRIIFDYLVLERKLMVSVG
Uniprot No.

Target Background

Function
This protein is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is Rhodothermus marinus and why is it important in research?

Rhodothermus marinus is a thermophilic bacterium belonging to the phylum Bacteroidetes, specifically to the proposed family "Rhodothermaceae" . It was isolated from submarine hot springs and grows optimally at temperatures between 55-77°C . R. marinus has gained research attention for several key reasons:

  • It possesses thermostable enzymes useful for biotechnological applications

  • It can grow on a wide range of sugars from second and third generation biomass

  • It has potential as a thermophilic cell factory for biorefinery applications

  • It produces valuable compounds such as carotenoids and exopolysaccharides

The thermophilic nature of R. marinus makes it particularly valuable for bioprocess engineering as elevated temperatures can improve biorefinery economics by decreasing cooling costs and reducing contamination risks .

  • What is the SecD protein and what role does it play in bacterial systems?

The SecD protein is a subunit of the bacterial Sec protein translocation machinery, which is responsible for transporting proteins across the cytoplasmic membrane . The Sec machinery comprises several components:

  • The SecYEG complex forms the protein-conducting channel in the membrane

  • SecA provides the ATP-driven force for translocation

  • Accessory components like SecD, SecF, YidC, and YajC form a supercomplex with SecYEG to enhance translocation efficiency

In R. marinus, the SecD protein is encoded by the gene Rmar_1455 . SecD functions to improve the efficiency of protein translocation by helping maintain the proton motive force across the membrane and preventing backward movement of translocating polypeptides .

  • How does the Sec translocation system generally function in bacteria?

The Sec machinery provides a major pathway for protein translocation across the bacterial cytoplasmic membrane and operates through several coordinated steps:

  • Nascent secretory proteins are recognized by either the signal recognition particle (SRP) or SecA based on their N-terminal signal sequences

  • SecA binds to preproteins and targets them to the SecYEG translocon

  • Through repeated cycles of ATP binding and hydrolysis, SecA drives the translocation of the unfolded polypeptide through the SecYEG channel

  • Accessory proteins like SecD and SecF enhance the efficiency of this process

The Sec system can operate through two main pathways:

  • Translationally coupled translocation (CT): SRP recognizes signal sequences early during translation and targets ribosome-nascent chain complexes to SecYEG

  • Translationally uncoupled translocation (UT): SecA recognizes completed preproteins and, together with chaperone SecB, maintains them in an unfolded state for post-translational translocation

Experimental Methods and Approaches

  • How can I express and purify recombinant R. marinus SecD protein?

Expression and purification of recombinant R. marinus SecD typically follows these methodological steps:

  • Cloning: The secD gene (Rmar_1455) can be amplified from R. marinus genomic DNA and cloned into an appropriate expression vector

  • Expression hosts: The recombinant protein can be expressed in various systems:

    • E. coli (most common)

    • Yeast

    • Baculovirus

    • Mammalian cell systems

  • Purification: The protein can be purified to ≥85% purity using SDS-PAGE-based methods

When working with membrane proteins like SecD, it's important to optimize detergent conditions for extraction and purification to maintain protein structure and function.

  • What genetic tools are available for manipulating R. marinus?

Several genetic tools have been developed for R. marinus, enabling targeted gene deletions and expression studies:

Genetic ToolDescriptionApplication
Selection markerstrpB (tryptophan synthase)Complementation of trpB1 mutant strains for selection
purA (adenylosuccinate synthase)Confers adenine prototrophy
Shuttle vectorspRM3000, pRM3000.0Plasmids for gene expression in R. marinus
Transformation protocolElectroporationYields up to 1×10^7 Trp+ transformants per μg DNA

The development of unmarked deletion strategies using the trpB and purA markers has been particularly valuable, as demonstrated in strain SB-62 (ΔtrpBΔpurA), allowing for sequential genetic modifications . Transformation is typically performed using electroporation with pulses delivered at 20 kV/cm .

  • What cultivation methods can be used to grow R. marinus for protein expression studies?

Several cultivation techniques have been developed for R. marinus:

  • Growth media options:

    • Medium 162 with modifications (2 mM MgSO₄, 0.2 mM CaCl₂)

    • Marine Broth 2216 (MB)

    • Lysogeny Broth (LB) with 1% NaCl

    • Defined medium (DRM) with optimized levels of CaSO₄, MgCl₂, phosphate, and NH₄Cl

  • Cultivation strategies:

    • Batch cultivation in bioreactors

    • Fed-batch cultivation

    • Sequential batch cultivation with cell recycling (SBCR)

SBCR cultivation has been particularly effective for achieving higher cell densities:

  • Cell density increased threefold (OD₆₂₀ = 20) in LB with maltose

  • Cell density increased eightfold (OD₆₂₀ = 14) in MB with maltose

Optimal growth conditions for R. marinus include:

  • Temperature: 65-70°C

  • pH: 7.0-7.5

  • NaCl: 1-2%

  • Carbon source: Addition of 10 g/L maltose has been shown to enhance growth

Advanced Research Questions

  • How does SecD interact with other components of the Sec translocation machinery?

SecD interacts with multiple components of the Sec translocation machinery to form a functional supercomplex:

  • SecD and SecF form a complex (SecDF) that associates with the SecYEG translocon

  • This association enhances the efficiency of protein translocation by utilizing the proton motive force

  • SecD also interacts with YidC and YajC to form a larger supercomplex

In R. marinus, these interactions may be particularly important under thermophilic conditions, where protein stability and interaction dynamics differ from mesophilic systems. The structural genes encoding the four subunits of the HiPIP:oxygen oxidoreductase were found to be organized in an operon, suggesting coordinated expression and function of these components .

  • What is known about the structure-function relationship of SecD in thermophilic bacteria?

While detailed structural information specific to R. marinus SecD is limited, studies on the Sec machinery in other organisms provide insights into potential structure-function relationships:

  • SecD contains multiple transmembrane domains and a large periplasmic domain

  • The periplasmic domain is thought to interact with translocating polypeptides

  • In thermophilic organisms, SecD likely has adaptations that enhance stability at higher temperatures

Research suggests that SecD uses proton motive force to prevent backward sliding of translocating polypeptides, possibly through conformational changes in its periplasmic domain .

  • How do the thermal stability mechanisms of R. marinus SecD compare to its mesophilic homologs?

As a protein from a thermophilic organism, R. marinus SecD likely employs several strategies for thermal stability that differentiate it from mesophilic homologs:

  • Increased number of ionic interactions and hydrogen bonds

  • Higher proportion of hydrophobic amino acids in the protein core

  • Reduction in flexible loops and thermolabile residues

  • Potentially higher GC content in the encoding gene

R. marinus belongs to the phylum Bacteroidetes and grows at temperatures up to 77°C, suggesting its proteins, including SecD, have evolved significant thermostability . The average GC content of related Rhodothermaceae (e.g., Rubricoccus marinus at 68.9 mol%) is among the highest known for this family, potentially contributing to DNA stability at elevated temperatures .

Research Challenges and Methodological Considerations

  • What are the challenges in studying protein translocation in thermophilic systems?

Studying protein translocation in thermophiles like R. marinus presents several methodological challenges:

  • Protein stability concerns: Working with membrane proteins at elevated temperatures can lead to aggregation and loss of native structure

  • Reconstitution challenges: Creating functional in vitro systems that accurately reflect in vivo conditions at high temperatures

  • Assay limitations: Many conventional assays for translocation are not optimized for thermophilic conditions

  • Growth challenges: Achieving high cell densities for protein production, as R. marinus growth often stagnates prematurely

To overcome these challenges, researchers have developed specialized approaches:

  • Sequential batch cultivation with cell recycling (SBCR) to increase cell density

  • Optimization of growth media composition based on metabolic modeling

  • Development of genetic tools specific to R. marinus

  • How can genome-scale metabolic modeling inform SecD research in R. marinus?

Genome-scale metabolic modeling provides valuable insights for SecD research in R. marinus:

  • A genome-scale metabolic model of R. marinus DSM 4252T has been constructed to predict growth behavior and metabolic capabilities

  • The model correctly predicted growth rates and can be used to optimize media composition

  • This model can inform decisions about growth conditions for optimal protein expression

  • Metabolic modeling can reveal connections between central metabolism and protein secretion processes

For example, modeling has helped identify limiting factors in defined media for R. marinus growth:

  • Analysis indicated that the original DMB medium contained barely enough phosphate

  • Higher ammonium concentration improved glucose uptake

  • These insights led to formulation of an improved defined medium (DRM)

  • What strategies can improve heterologous expression of R. marinus SecD?

Several strategies can enhance heterologous expression of R. marinus SecD:

  • Codon optimization: Adapting the secD gene sequence to the codon usage of the expression host

  • Expression temperature: Using lower temperatures during induction while maintaining protein solubility

  • Fusion tags: Employing solubility-enhancing fusion partners (e.g., MBP, SUMO)

  • Specialized expression hosts: Using hosts adapted for membrane protein expression

When expressing thermophilic membrane proteins like SecD in mesophilic hosts, it's essential to balance expression levels with membrane integration capacity to avoid toxicity and inclusion body formation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.