Recombinant Rhodothermus marinus Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Rhodothermus marinus Protein Translocase Subunit SecF (secF) is a bacterially or mammalian cell-expressed protein involved in the Sec-dependent protein translocation system. This system enables the transport of precursor proteins across or into bacterial membranes. SecF forms part of the SecDF complex, which collaborates with SecYEG and SecA ATPase to facilitate ATP-independent protein translocation using proton motive force (PMF) .

Domain Architecture

  • Transmembrane domain: 12-helix structure belonging to the RND (Resistance-Nodulation-Division) superfamily .

  • Periplasmic domains: P1 and P4, which undergo conformational changes critical for substrate binding and translocation .

SecF interacts with multiple components critical for protein export:

Partner ProteinFunctionInteraction Score
SecDForms the SecDF complex; utilizes PMF for translocation0.999
YidCMembrane protein insertion chaperone0.825
SecYCore subunit of the SecYEG channel0.822
SecGStabilizes SecYEG during translocation0.717

Expression and Purification

  • Source: Rhodothermus marinus (strain ATCC 43812/DSM 4252) .

  • Tag: N-terminal His-tag or untagged, depending on expression system .

  • Purity: >85% (SDS-PAGE) .

Functional Studies

  • Electrophysiological assays confirmed proton conductance by SecDF, essential for ATP-independent translocation .

  • In vitro assays demonstrated SecDF’s ability to complete translocation after SecA inactivation .

Genomic and Biotechnological Context

  • Genomic Data: R. marinus strains (e.g., DSM 4252) encode SecF within a 3.26–3.44 Mb chromosome, alongside other Sec components .

  • Biotech Relevance: Recombinant SecF is used in ELISA kits and as a research tool for studying thermostable protein translocation mechanisms .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance for an additional fee.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, serving as a reference for your use.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type preferences, please inform us, and we will prioritize development accordingly.
Synonyms
secF; Rmar_1454; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Rhodothermus marinus (strain ATCC 43812 / DSM 4252 / R-10) (Rhodothermus obamensis)
Target Names
secF
Target Protein Sequence
MRIFENANYPFVQHRKKAYVFSGVLILLSLVSLVTRGLELGIDFKGGMEFIISGAREPGA TAIREALTPVLGTEPEVKTYGAEDILIRVAAEGDINEVQRRIVETIRQRFPETQPEVVQT NIVGPRFAEDLKRGAIYSILGALLVIFVYILIRFEWRFSLGAVVALFHDVLITLGLFSLL HGWLPFSLEIDQTIIAAFLTIVGYSLNDTVVVFDRIREYMNIFKTKPFEEVVNLSINTTL SRTIITSGTTLLVVVILFIFGGEVLRGFSFALIVGIVIGTYSSIFVASPVVIELRARAAA RRRLATAR
Uniprot No.

Target Background

Function
This protein is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA.
Database Links
Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the Protein translocase subunit SecF from Rhodothermus marinus?

The Protein translocase subunit SecF from Rhodothermus marinus is a component of the bacterial Sec protein translocation pathway. It functions as part of the SecYEG-SecDF complex responsible for transporting proteins across the cytoplasmic membrane. The protein from Rhodothermus marinus has a UniProt accession number D0MIN3 and is encoded by the secF gene (Rmar_1454). The full-length protein consists of 308 amino acid residues and participates in protein secretion and membrane protein insertion mechanisms.

Why is Rhodothermus marinus SecF relevant for research in protein translocation?

Rhodothermus marinus SecF is particularly valuable for protein translocation research due to its thermostable properties. As R. marinus is a thermophilic bacterium, its proteins, including SecF, exhibit exceptional stability at high temperatures. This thermostability makes it an ideal model system for studying fundamental mechanisms of protein translocation that might be difficult to investigate with less stable homologs. Additionally, the thermostable nature of this protein allows researchers to conduct experiments under conditions that may reduce background noise and increase experimental reproducibility.

What are the optimal storage conditions for Recombinant R. marinus SecF?

The recombinant Rhodothermus marinus SecF protein should be stored in Tris-based buffer containing 50% glycerol. For long-term storage, it is recommended to keep the protein at -20°C or -80°C. Working aliquots can be maintained at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they may compromise protein integrity and function. When creating aliquots, sterile conditions should be maintained to prevent microbial contamination that could lead to protein degradation.

What expression systems are most suitable for producing R. marinus SecF?

Based on the available research data, Escherichia coli expression systems have been successfully used for heterologous expression of thermophilic proteins from Rhodothermus marinus. While not specifically documented for SecF, related thermostable proteins from R. marinus have been efficiently expressed in E. coli. The following table summarizes key considerations for expression system selection:

Expression SystemAdvantagesChallengesRecommendations
E. coli (BL21)High yield, widely established protocolsPotential inclusion body formationOptimize induction temperature (18-25°C)
E. coli (Arctic Express)Better folding at lower temperaturesLower yieldBeneficial for proteins prone to misfolding
Cell-free systemsAvoids toxicity issuesHigher cost, lower yieldConsider for toxic membrane proteins
Yeast systemsPost-translational modificationsMore complex than E. coliNot typically necessary for bacterial proteins

For optimal results, expression constructs should include an affinity tag (His-tag or similar) for purification, and expression conditions should be optimized based on initial small-scale trials.

What purification methods work best for isolating R. marinus SecF while maintaining its activity?

Purification of R. marinus SecF should take advantage of its thermostability and utilize a multi-step approach:

  • Heat treatment: Initially exposing the crude lysate to 65-70°C for 15-20 minutes can denature many E. coli host proteins while leaving the thermostable SecF intact.

  • Immobilized Metal Affinity Chromatography (IMAC): If the recombinant protein contains a His-tag, IMAC is highly effective for initial purification.

  • Ion Exchange Chromatography: Based on the theoretical pI of SecF, either cation or anion exchange can be used as a secondary purification step.

  • Size Exclusion Chromatography: A final polishing step to separate aggregates, oligomeric forms, and remove any remaining impurities.

Throughout the purification process, it's essential to include appropriate detergents (typically mild non-ionic detergents like DDM or LDAO) in all buffers to maintain the solubility of this membrane protein. Purification buffers should also contain stabilizing agents such as glycerol (10-20%) to preserve protein activity.

How can structural studies of R. marinus SecF contribute to understanding the Sec translocon mechanism?

Structural studies of Rhodothermus marinus SecF can provide critical insights into the Sec translocon mechanism for several reasons:

First, the thermostability of R. marinus SecF makes it an excellent candidate for crystallography or cryo-EM studies, as stable proteins typically yield better-quality structural data. These high-resolution structures can reveal the precise arrangement of transmembrane domains and protein-protein interaction interfaces involved in the translocation process.

Second, R. marinus SecF structures can be compared with homologs from mesophilic organisms to identify structural adaptations that contribute to thermostability while preserving essential functional features. This comparative analysis can distinguish conserved functional elements from variable regions.

Third, by obtaining structures of SecF in different conformational states (possibly through mutation or ligand binding), researchers can build a dynamic model of how this subunit participates in the protein translocation cycle.

For meaningful structural studies, researchers should consider using a combination of complementary techniques, including X-ray crystallography, cryo-EM, and solution-based methods like SAXS (Small Angle X-ray Scattering) or HDX-MS (Hydrogen-Deuterium Exchange Mass Spectrometry).

How does the thermostability of R. marinus SecF compare to SecF homologs from mesophilic organisms?

While specific comparative data for SecF is not directly available in the search results, insights can be drawn from studies on other thermostable proteins from Rhodothermus marinus. Typically, proteins from this thermophilic organism exhibit significantly higher thermostability compared to their mesophilic counterparts. For instance, alginate lyases from R. marinus demonstrate optimal activity at temperatures of 75-81°C, making them among the most thermophilic enzymes characterized.

For SecF specifically, we would expect:

  • Higher melting temperature (Tm): Likely 30-40°C higher than mesophilic homologs

  • Extended half-life at elevated temperatures: Maintaining activity for hours at temperatures where mesophilic variants would denature within minutes

  • Structural adaptations: Increased number of salt bridges, more compact hydrophobic core, and reduced flexible loops

A systematic comparative analysis between R. marinus SecF and well-characterized mesophilic SecF proteins (such as those from E. coli or B. subtilis) would involve thermal shift assays, circular dichroism measurements at increasing temperatures, and activity retention studies to quantitatively establish the thermostability differences.

What is the role of SecF in the context of the SecDF-YajC auxiliary complex?

SecF functions as part of the SecDF-YajC auxiliary complex that enhances the efficiency of the core SecYEG translocon. Based on studies of homologous systems, SecF is likely involved in several critical aspects of protein translocation:

  • PMF (proton motive force) utilization: SecDF couples proton gradients to protein movement, providing additional energy for translocation beyond ATP hydrolysis by SecA.

  • Late-stage translocation: The complex assists in the later stages of protein secretion, helping pull proteins through the SecYEG channel and release them on the external side of the membrane.

  • Conformational cycling: SecF undergoes conformational changes that are coordinated with SecD to facilitate directional movement of the translocating protein.

  • Membrane protein integration: The complex may have specialized roles in the lateral release of transmembrane segments into the lipid bilayer during membrane protein insertion.

In R. marinus specifically, the SecDF complex likely has adaptations that allow it to function efficiently at high temperatures, potentially with unique structural features that maintain critical protein-protein interactions under these extreme conditions.

What are the key considerations when designing functional assays for R. marinus SecF?

When designing functional assays for R. marinus SecF, researchers should account for several key factors:

  • Temperature optimization: Assays should be conducted at temperatures relevant to R. marinus physiology (optimal growth temperature ~65-70°C) or at least at elevated temperatures (50-80°C) where the protein functions most efficiently. Standard room temperature assays may significantly underestimate activity.

  • Reconstitution systems: As a membrane protein component of a complex machinery, SecF functionality is best assessed in reconstituted systems such as:

    • Proteoliposomes containing SecYEG and SecDF-YajC

    • Inverted membrane vesicles (IMVs) from expression hosts

    • Planar lipid bilayers for electrophysiological measurements

  • Coupled assays: Since SecF works as part of a larger translocation system, coupled assays that measure:

    • Protein translocation efficiency using model substrates

    • ATP hydrolysis rates by SecA in the presence of SecDF

    • Proton transport coupled to protein movement

  • Controls and comparisons: Include appropriate controls such as:

    • Inactive variants (site-directed mutants of key residues)

    • SecF homologs from mesophilic organisms

    • Assays in the absence of proton motive force

These considerations ensure that the unique properties of this thermophilic protein are properly accounted for in experimental design.

How can site-directed mutagenesis be used to investigate the functional domains of R. marinus SecF?

Site-directed mutagenesis is a powerful approach for investigating the functional domains of R. marinus SecF. Based on knowledge of protein translocase systems, several strategic mutagenesis approaches can be employed:

  • Conserved residue targeting: Identify highly conserved amino acids across SecF homologs, which likely play critical functional roles. Key targets would include:

    • Charged residues in transmembrane domains (potential proton relay)

    • Residues at protein-protein interfaces with SecD, YajC, or SecYEG

    • Amino acids in predicted substrate-binding regions

  • Domain-specific mutagenesis:

    • Periplasmic domain mutations to assess substrate interaction

    • Transmembrane region mutations to investigate proton translocation

    • Cytoplasmic loops to examine interactions with SecA or ribosomes

  • Thermostability determinant analysis: Create chimeric proteins by swapping domains between R. marinus SecF and mesophilic homologs to identify regions responsible for thermostability.

  • Cysteine-scanning mutagenesis: Introduce single cysteines systematically throughout the protein for subsequent labeling with fluorescent or spin probes to track conformational changes during the translocation cycle.

Following mutagenesis, mutant proteins should be assessed for:

  • Expression and stability at different temperatures

  • Ability to complement SecF-deficient strains

  • Protein translocation efficiency in reconstituted systems

  • Structural integrity through circular dichroism or thermal shift assays

What approaches can be used to study the interaction between R. marinus SecF and other components of the Sec translocon?

Several complementary approaches can be employed to investigate interactions between R. marinus SecF and other components of the Sec translocon:

  • Co-purification and pull-down assays:

    • Express tagged versions of SecF and potential interacting partners

    • Use tandem affinity purification to identify stable complexes

    • Apply crosslinking agents to capture transient interactions

  • Biophysical interaction analysis:

    • Surface Plasmon Resonance (SPR) to measure binding kinetics

    • Isothermal Titration Calorimetry (ITC) for thermodynamic parameters

    • Microscale Thermophoresis (MST) for interactions in solution

  • Structural biology approaches:

    • Cryo-EM of the entire SecYEG-SecDF-YajC complex

    • X-ray crystallography of subcomplexes

    • NMR analysis of specific domain interactions

  • Genetic approaches:

    • Suppressor mutation analysis to identify functional interactions

    • In vivo site-specific crosslinking using unnatural amino acids

    • Bacterial two-hybrid systems adapted for membrane proteins

  • Computational modeling:

    • Molecular dynamics simulations of the translocon complex

    • Protein-protein docking guided by experimental constraints

    • Evolutionary coupling analysis to identify co-evolving residues

These methods should be performed under conditions that account for the thermophilic nature of R. marinus proteins, potentially requiring modified protocols to ensure protein stability during interaction studies.

How does R. marinus SecF compare to SecF proteins from other extremophiles?

R. marinus SecF represents an interesting case for comparative analysis with SecF proteins from other extremophilic organisms. While direct comparative data between various extremophile SecF proteins is not provided in the search results, we can infer several important comparisons based on general principles of protein adaptation to extreme environments:

A systematic bioinformatic analysis comparing amino acid composition, predicted secondary structure elements, and conservation patterns across SecF homologs from various extremophiles would yield valuable insights into environment-specific adaptations of this essential protein translocation component.

What evolutionary adaptations enable the thermostability of R. marinus SecF?

The thermostability of R. marinus SecF likely results from multiple evolutionary adaptations that collectively enhance protein stability at high temperatures. Based on knowledge of thermophilic proteins, including those from R. marinus, several key adaptations can be identified:

  • Primary sequence modifications:

    • Increased proportion of charged amino acids (Arg, Lys, Glu, Asp) that form stabilizing salt bridges

    • Higher content of hydrophobic residues with branched side chains (Ile, Val, Leu)

    • Reduced number of thermolabile residues prone to deamidation or oxidation

    • Strategic proline residues in loops to reduce conformational flexibility

  • Structural stabilization mechanisms:

    • Enhanced hydrophobic core packing

    • Increased number of ion pairs, particularly networked salt bridges

    • Shorter surface loops with reduced flexibility

    • Additional hydrogen bonding networks

  • Folding and dynamics properties:

    • Potentially slower folding but with more cooperative transitions

    • Reduced conformational flexibility at moderate temperatures

    • Maintained essential dynamics at elevated temperatures where mesophilic proteins would denature

How can R. marinus SecF be utilized in synthetic biology applications?

The unique properties of R. marinus SecF offer several promising applications in synthetic biology:

  • Thermostable protein secretion systems: Incorporating R. marinus SecF into engineered protein secretion systems could enable more efficient protein export at elevated temperatures, which is particularly valuable for industrial enzymes that function optimally under such conditions.

  • Chassis development for high-temperature bioprocesses: Engineering thermophilic expression hosts with optimized protein secretion capabilities using R. marinus SecF could create platforms for producing and secreting enzymes for biofuel production, biomass degradation, or other high-temperature bioprocesses.

  • Protein folding quality control: The SecDF complex contributes to protein folding and quality control. R. marinus components could potentially be engineered into mesophilic systems to enhance protein folding fidelity under stress conditions.

  • Membrane protein production systems: Creating hybrid Sec translocons incorporating thermostable components like R. marinus SecF might improve the notoriously difficult production of membrane proteins for structural and functional studies.

  • Directed evolution platforms: The inherent stability of R. marinus SecF provides an excellent starting point for directed evolution experiments aimed at creating secretion systems with novel properties or substrate specificities.

To fully realize these applications, researchers would need to characterize the compatibility of R. marinus SecF with other Sec components from various organisms and determine the optimal conditions for its function in heterologous systems.

What are the current limitations in studying R. marinus SecF and how might they be overcome?

Current research on R. marinus SecF faces several significant limitations:

  • Complex membrane protein biochemistry: As a membrane protein, SecF presents inherent challenges in expression, purification, and structural characterization. This limitation might be addressed by:

    • Developing improved detergent or nanodisc systems specifically optimized for thermostable membrane proteins

    • Employing new solubilization approaches like SMALPs (Styrene Maleic Acid Lipid Particles)

    • Creating stable, soluble domains or chimeric constructs for easier structural analysis

  • Reconstitution of the complete translocation system: Studying SecF in isolation provides limited functional insights, as it operates as part of a complex machinery. Advances might include:

    • Developing co-expression systems for the entire thermophilic Sec translocon

    • Creating hybrid systems with well-characterized components from model organisms

    • Establishing high-throughput functional assays in reconstituted systems

  • Limited comparative data: The scarcity of research specifically on R. marinus SecF compared to model organisms limits comparative analyses. This could be addressed by:

    • Systematic characterization of SecF proteins across a temperature gradient of related organisms

    • Creating a dedicated database of translocon components from extremophiles

    • Applying standardized assays across multiple SecF homologs

  • Technical challenges of high-temperature biochemistry: Working with proteins at their physiological temperatures (65-80°C) presents practical challenges that might be overcome by:

    • Developing specialized equipment for high-temperature protein biochemistry

    • Creating novel reporter systems stable at elevated temperatures

    • Utilizing computational approaches to complement experimental limitations

What are common pitfalls when working with recombinant R. marinus SecF and how can they be addressed?

Researchers working with recombinant R. marinus SecF may encounter several challenges that require specific troubleshooting approaches:

  • Low expression yields:

    • Problem: SecF, being a membrane protein, often expresses poorly in heterologous systems.

    • Solutions:

      • Optimize codon usage for the expression host

      • Try different promoter strengths and induction conditions

      • Consider specialized E. coli strains designed for membrane protein expression (C41/C43)

      • Explore fusion partners that enhance membrane protein expression (Mistic, GFP)

  • Protein aggregation during purification:

    • Problem: Improper solubilization or detergent exchange can lead to aggregation.

    • Solutions:

      • Screen multiple detergents (DDM, LDAO, LMNG) for optimal solubilization

      • Include stabilizing additives (glycerol, specific lipids, osmolytes)

      • Maintain samples at moderate temperatures during purification despite thermostability

      • Consider on-column detergent exchange to minimize aggregation

  • Loss of activity during storage:

    • Problem: Even thermostable proteins can lose activity during prolonged storage.

    • Solutions:

      • Store at -80°C in small aliquots to avoid freeze-thaw cycles

      • Include cryoprotectants in storage buffers

      • Verify activity before experiments with simple activity assays

      • Consider lyophilization for long-term storage if applicable

  • Difficulty reconstituting functional complexes:

    • Problem: SecF functions as part of a multi-protein complex that can be challenging to reconstitute.

    • Solutions:

      • Start with binary complexes (SecF-SecD) before attempting larger assemblies

      • Optimize lipid composition for reconstitution based on R. marinus membrane lipids

      • Use step-wise reconstitution protocols with careful monitoring of protein incorporation

      • Validate function with well-established translocation substrates

How can the thermostability of R. marinus SecF be leveraged to improve experimental outcomes?

The exceptional thermostability of R. marinus SecF can be strategically leveraged to enhance experimental outcomes in several ways:

  • Purification advantages:

    • Implement heat treatment steps (65-75°C for 15-20 minutes) during purification to selectively denature contaminant proteins while preserving SecF

    • Perform chromatography steps at elevated temperatures to maintain protein solubility while reducing bacterial contamination

    • Use more stringent washing conditions during affinity purification without compromising protein integrity

  • Structural studies enhancement:

    • Benefit from reduced molecular motion at standard temperatures, potentially yielding better-quality crystals for X-ray crystallography

    • Exploit the inherent stability for longer data collection periods in structural studies

    • Utilize the protein's resistance to radiation damage during crystallographic or cryo-EM analysis

  • Functional assay improvements:

    • Conduct experiments at elevated temperatures where background enzymatic activities from contaminating proteins are minimized

    • Perform longer duration experiments without significant protein degradation

    • Design thermal shift assays to assess interactions with other components or small molecules

  • Storage and handling benefits:

    • Maintain activity during shipping or temporary storage at room temperature

    • Reduce concerns about protein degradation during experimental setup

    • Allow for more flexibility in experimental conditions, including testing in the presence of denaturants or solubilizing agents

By thoughtfully incorporating these approaches into research protocols, scientists can transform the thermostability of R. marinus SecF from a biological curiosity into a practical advantage for advancing our understanding of protein translocation mechanisms.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.