Recombinant Rhomboid-like protease 1 (ROM1)

Shipped with Ice Packs
In Stock

Description

Definition and Mechanism of Recombinant Rhomboid-like Protease 1 (ROM1)

Recombinant Rhomboid-like protease 1 (ROM1) is a serine protease belonging to the rhomboid family, which cleaves substrates within transmembrane domains. In Plasmodium species (malaria parasites), ROM1 plays critical roles in invasion, intracellular development, and survival within host cells . While naturally occurring ROM1 is expressed in invasive stages (e.g., sporozoites, merozoites), recombinant versions are engineered for functional studies, enabling precise analysis of its enzymatic activity and substrate interactions.

Functional Roles in Parasite Development

ROM1 demonstrates stage-specific roles across Plasmodium species:

SpeciesKey FunctionsExperimental Evidence
Plasmodium yoeliiModifies parasitophorous vacuole (PV) structure in hepatocytes; ensures survivalROM1-deficient parasites show PV defects in liver stages; no invasion impairment
Plasmodium bergheiFacilitates sporozoite infection of liver; promotes merozoite invasionROM1(−) mutants show reduced liver infection efficiency; mice infected with mutants develop protective immunity
Plasmodium vivaxExpressed in all erythrocytic stages; potential role in RBC invasionPvROM-like 1 detected in ring, trophozoite, and schizont stages via SDS-PAGE/Western blot

Expression Patterns

  • Sporozoites:

    • P. yoelii: ROM1 mRNA upregulated 2-fold in salivary gland sporozoites vs. midgut sporozoites; protein detectable in salivary gland stages .

    • P. berghei: Localizes to sporozoite surface post-salivary gland invasion .

  • Blood Stages:

    • P. vivax: PvROM-like 1 detected in all erythrocytic stages (0–48 h post-infection) using anti-PfROM1 antibodies .

Knockout Models

SpeciesPhenotypeOutcome
P. bergheiROM1(−) sporozoites68% reduction in liver infection compared to wild-type
P. yoeliiROM1-deficient parasitesNormal invasion but PV formation defects; increased host clearance
P. vivaxN/A (no knockout data)PvROM-like 1 expression confirmed in clinical isolates

Substrate Processing and PV Modification

  • Hypothesized Activity: ROM1 may cleave proteins involved in PV membrane modification (e.g., UIS4) or signal parasite differentiation .

  • Enzymatic Specificity: Unlike Toxoplasma gondii ROM4 (a sheddase), ROM1 does not directly cleave adhesins during invasion but acts post-entry .

Gene Diversity in P. vivax

MetricWest ThailandEast ThailandCombined
Sequences474592
Segregating Sites668
Tajima’s D−1.56−1.56−1.61
Fst (West vs. East)0.540.00

Data sourced from genetic diversity analysis of PvROM-like 1 in Thailand .

Implications for Malaria Interventions

  • Target Validation: ROM1’s role in PV stabilization and immune evasion makes it a candidate for antimalarial strategies .

  • Vaccine Potential: In P. berghei, ROM1(−) infection elicits protective immunity, suggesting ROM1-based vaccines could prevent reinfection .

Research Gaps and Future Directions

  1. Substrate Identification: Proteomic studies to map ROM1 substrates remain critical.

  2. Species-Specific Roles: Divergent functions in P. vivax (RBC invasion) vs. P. yoelii (PV modification) warrant comparative analysis.

  3. Recombinant Applications: Engineered ROM1 variants could dissect catalytic vs. structural roles in invasion assays.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ROM1; Rhomboid-like protease 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-293
Protein Length
full length protein
Species
Toxoplasma gondii
Target Names
ROM1
Target Protein Sequence
MARVRTLADLRTEDEADEHTPLYNAETGSRDSDSTSSGGAAPRSMPIRFLELLFPHFSLK SVVLAISIVDWIFYIVTVCLDTELPLIPAANILVHFGANYPPLIKQGQVWRLLLPVFLHA NFFHVFFNVFFQLRMGFTIERRYGLLKFTGLYFASAIYGNLLSATAFFCNSLKVGASTAG FGLIGIQICEMALTWHRMRHRDRMLTNMVSFVLLMVLLMFTLNGGSIDQMGHLGGLLCGF SIGMLYNKELNDKPVWYPWASAAAIGILLALPAACFPILYAVDRHCHRDLSYI
Uniprot No.

Target Background

Function

Recombinant Rhomboid-like protease 1 (ROM1) is a serine protease involved in intramembrane proteolysis. Its function is to release polypeptides from their membrane anchors. Note that it exhibits no detectable activity towards MIC2.

Protein Families
Peptidase S54 family
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, microneme membrane; Multi-pass membrane protein. Note=Detected in micronemes in intracellular and extracellular tachyzoites, together with MIC2.

Q&A

What is ROM1 and what is its primary biological role?

ROM1 (Rod Outer segment Membrane protein 1) is a tetraspanin protein that functions as a molecular building block of photoreceptor disc rims in the retina. It works alongside PRPH2 (peripherin-2) to form and maintain the structure of disc rims and contributes to the process of disc enclosure . ROM1 forms core tetraspanin complexes through both non-covalent interactions and disulfide bridges, playing a distinct role in the formation of normal outer segments in photoreceptors .

How does ROM1 differ from other rhomboid proteases?

While ROM1 in photoreceptors is not itself a protease, rhomboid domain proteins like RHBDD1 (Rhomboid Domain Containing 1) are intramembrane serine proteases that cleave transmembrane substrates. RHBDD1, for instance, interacts with proTGFα and induces its cleavage and secretion, triggering EGFR pathway activation . Unlike typical rhomboid proteases that are involved in proteolytic activities, ROM1 primarily serves a structural role in photoreceptor disc organization, highlighting the diverse functions within this protein family .

What knockout models have been most informative for ROM1 research?

ROM1 knockout (Rom1-/-) mice have provided critical insights into ROM1 function. These models reveal several key phenotypes:

  • Compensatory increase in PRPH2 relative disc content

  • Delay in disc maturation

  • Increased outer segment diameter

  • Absence of disc rim indentations (incisures)

Despite these morphological changes, the total tetraspanin content remains similar to wild-type discs . These models demonstrate that while ROM1 contributes to normal disc formation, its function can be largely compensated by increased PRPH2 expression .

What techniques are most effective for studying ROM1-PRPH2 interactions?

Multiple complementary techniques have proven valuable for studying ROM1-PRPH2 interactions:

TechniqueApplicationKey Findings
Co-immunoprecipitationProtein-protein interaction verificationConfirms direct binding between ROM1 and PRPH2
Velocity sedimentationOligomerization status analysisROM1 and PRPH2 sediment in fractions #6–8, indicating core complex formation
Non-reducing SDS-PAGEDisulfide-linked complex analysisPRPH2 appears as ~35 kDa monomers and ~75 kDa disulfide-linked dimers
Quantitative proteomicsProtein level measurementReveals compensatory PRPH2 increase in ROM1 knockout
Transmission electron microscopyStructural analysisIdentifies absence of incisures in ROM1-/- discs

These methods collectively provide a comprehensive understanding of the structural and functional relationship between these tetraspanins .

How does the oligomerization status of tetraspanins affect photoreceptor disc formation?

The oligomerization status of tetraspanins is critical for proper disc morphogenesis. Research shows that defects in PRPH2 oligomerization, even without decreased PRPH2 levels, lead to impaired disc enclosure . In wild-type retinas, PRPH2 predominantly exists as disulfide-linked dimers, consistent with its organization within larger oligomeric structures.

In ROM1 knockout mice, there's a shift toward PRPH2 monomers, suggesting ROM1 influences PRPH2's oligomerization state . ROM1 appears to facilitate optimal internal disulfide bond arrangement in PRPH2 and promotes formation of larger oligomeric chains necessary for proper disc enclosure and incisure formation .

What is the relationship between total tetraspanin content and disc morphology?

A complex relationship exists between tetraspanin content and disc morphology. Current models suggest the total disc rim length (including incisures) is determined by the molar ratio between total tetraspanin protein and rhodopsin .

In ROM1 knockout mice, despite having similar total tetraspanin content as wild-type (due to compensatory PRPH2 increase), discs lack incisures and have increased diameter . This reveals an interesting tradeoff: the total rim length remains approximately the same, but its distribution differs. Without ROM1, all tetraspanin is allocated to the disc circumference, resulting in larger discs without incisures .

Can PRPH2 functionally replace ROM1, and what does this tell us about tetraspanin redundancy?

Transgenic overexpression of PRPH2 can rescue the morphological defects associated with ROM1 deficiency, indicating that ROM1 is functionally redundant to PRPH2 as a building block of photoreceptor disc rims . This redundancy suggests that the absolute quantity of tetraspanins, rather than their specific identity, may be the primary determinant of proper disc morphology in many contexts.

How is RHBDD1 (a rhomboid protease) involved in cancer progression?

RHBDD1 is highly expressed in colorectal cancer and closely associated with patient survival . Mechanistically, RHBDD1 interacts with proTGFα and induces its ADAM-independent cleavage and secretion, which subsequently activates the EGFR/Raf/MEK/ERK signaling pathway . This pathway plays a crucial role in promoting tumor cell growth.

Statistical analysis reveals that RHBDD1 expression is significantly correlated with:

These correlations highlight RHBDD1's potential as both a prognostic marker and therapeutic target in colorectal cancer .

What therapeutic implications arise from our understanding of ROM1 redundancy?

The ability of excess PRPH2 to compensate for ROM1 deficiency suggests potential therapeutic strategies for retinal conditions associated with ROM1 dysfunction . This redundancy indicates that PRPH2 overexpression might prevent or ameliorate photoreceptor degeneration resulting from ROM1 loss or mutation.

Interestingly, the research raises the possibility that the reverse may also be true – excess ROM1 might potentially rescue certain defects associated with PRPH2 mutations . This bidirectional compensation between tetraspanins represents an important avenue for future therapeutic research, particularly for inherited retinal dystrophies caused by mutations in either protein.

How do recombinant chimeric constructs help elucidate ROM1 function?

The RRCT chimeric protein (ROM1 bearing the C-terminus of PRPH2) has been instrumental in understanding ROM1's functional domains. In knockin mice where PRPH2 was replaced by RRCT, photoreceptors failed to form orderly disc stacks, yet outer segment membranes preserved the ability to form hairpin-shaped rims .

In cell culture experiments, RRCT and ROM1 co-localized in distinct structures and formed core tetraspanin complexes similar to those in wild-type photoreceptors, even in the absence of PRPH2 . This indicates that the ability to form these complexes is intrinsic to the tetraspanin structure, with the C-terminal domain potentially conferring specific functional properties.

What are appropriate quantitative and qualitative methods for comprehensive ROM1 research?

A mixed-methods approach is optimal for ROM1 research:

Quantitative Methods:

  • Expression analysis through immunoblotting and proteomics

  • Structural measurements of disc parameters

  • Statistical analysis of protein distribution and oligomerization

  • Survival analysis for disease relevance

Qualitative Methods:

  • Transmission electron microscopy for morphological analysis

  • Co-immunoprecipitation for protein interaction studies

  • Cell culture models for localization studies

  • Functional studies in knockout/knockin animals

This complementary approach allows researchers to both measure phenomena quantitatively and understand the underlying mechanisms qualitatively, which is essential for complex biological systems like photoreceptor discs .

What unresolved questions remain about ROM1 function and regulation?

Several important questions remain unexplored:

  • The precise molecular mechanisms by which ROM1 influences PRPH2 oligomerization

  • The role of post-translational modifications in regulating ROM1 function

  • The kinetics of disc enclosure and how ROM1 contributes to this process

  • Whether therapeutic overexpression of ROM1 can prevent degeneration in models with PRPH2 mutations

How might systems biology approaches enhance our understanding of ROM1 in photoreceptor biology?

The integration of quantitative data on protein expression with qualitative structural information could create predictive models of disc formation that account for the complex interplay between different tetraspanins and other outer segment proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.