Recombinant Rhomboid-like protease 2 (ROM2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline for your use.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
ROM2; Rhomboid-like protease 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-283
Protein Length
full length protein
Species
Toxoplasma gondii
Target Names
ROM2
Target Protein Sequence
MANIRTLSDYASSPPRGSSALEGEVGQGGSPLPLFFPSGTQSGENVSWIQWLCPGIHLKS PIIIISFVQIAVYIASLAAGLAPNEILAPTPQTLVMFGANIPELIRVGEIWRLICPLFLH LNLFHILMNLWVQIRIGLTMEEKYGWKMLLAVYFGVGVLANMISAAVLFCGQMKAGASTA VFALIGVQLAELALIWHAIQDRNSAIISVCICLFFVFVSSFGSHMDSVGHIGGLVMGFAA GIWLNENSDIKPTWYDRARLTSQVALAAAPILSCIFIFLVPRC
Uniprot No.

Target Background

Function
A serine protease involved in intramembrane proteolysis and the subsequent release of polypeptides from their membrane anchors.
Protein Families
Peptidase S54 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Rhomboid-like protease 2 (RHBDL2) and what is its biological significance?

Rhomboid-like protease 2 (RHBDL2) is a member of the rhomboid family of integral membrane proteins that function as intramembrane serine proteases. These proteases are evolutionarily conserved from prokaryotes to eukaryotes. RHBDL2 plays a critical role in releasing soluble growth factors through proteolytic cleavage of specific membrane-bound substrates, including ephrin B2 and ephrin B3 .

The biological significance of RHBDL2 stems from its involvement in signaling pathways that regulate various cellular processes. As a serine-type endopeptidase, it catalyzes the hydrolysis of peptide bonds within the transmembrane domains of target proteins, allowing for the release of functional protein domains from the membrane . This mechanism represents an important post-translational regulatory process that influences cellular communication and development.

How is RHBDL2 structurally and functionally different from other rhomboid proteases?

RHBDL2 shares core structural features with other rhomboid proteases while exhibiting unique substrate specificity. Like other rhomboid family members, RHBDL2 contains conserved architectural motifs known as keystones that are essential for its proteolytic function . Specifically, keystones III and IV contain critical residues (such as positions A127, G128, and A186 identified in yeast Rbd2) that, when mutated, can abolish protease activity .

Unlike many other rhomboid proteases, RHBDL2 has been observed to cleave after large hydrophobic residues in substrate proteins, a property that distinguishes it from its counterparts . For example, while the yeast rhomboid Rbd2 (which shares functional similarities with RHBDL2) inefficiently cleaves the bacterial substrate TatA in its wild-type form, it exhibits enhanced cleavage efficiency when the substrate contains an A8L mutation that introduces a large hydrophobic residue at the cleavage site .

The following table summarizes key distinguishing features of RHBDL2 compared to other rhomboid proteases:

FeatureRHBDL2/Rbd2Other Rhomboid Proteases
Substrate preferenceCan efficiently cleave after large hydrophobic residuesTypically cleave between small residues
TatA A8L mutant cleavageEnhanced (4-fold higher)Significantly reduced
Primary cleavage locationAfter large hydrophobic residuesOften between small-small amino acid pairs
Cellular locationGolgi apparatusVarious (ER, plasma membrane, mitochondria)

What are the established substrates of RHBDL2 and how were they identified?

RHBDL2 has several established substrates, primarily identified through biochemical and cell-based assays. The known substrates include:

  • Ephrin B2 and Ephrin B3: These membrane-bound proteins involved in cell signaling were identified as RHBDL2 substrates through their proteolytic release from cell membranes in the presence of active RHBDL2 .

  • TatA: While not a natural substrate in mammalian systems, the bacterial protein TatA has been used as a model substrate for studying RHBDL2/Rbd2 activity. Experimental evidence shows that Rbd2 can cleave TatA, particularly when it contains specific mutations such as A8L .

Substrate identification typically involves co-expression of candidate substrates with the protease in cellular systems, followed by detection of cleaved products using techniques such as Western blotting. Mass spectrometry is then employed to precisely determine the cleavage sites, as demonstrated in the study that identified cleavage of the TatA A8L mutant after the leucine at position 8 and a secondary cleavage site after phenylalanine at position 10 .

What are the recommended methods for recombinant expression of RHBDL2?

Recombinant expression of RHBDL2 presents several challenges that researchers should address through specific methodological approaches:

  • Codon optimization: Standard expression of RHBDL2 in heterologous systems like HEK293 cells typically results in low protein levels. Research has shown that codon optimization of the entire RHBDL2 open reading frame can significantly enhance expression, with documented increases of >35-fold compared to non-optimized sequences .

  • Epitope tagging strategy: For detection and purification purposes, adding a 3xHA tag to RHBDL2 has proven effective. The tag position should be carefully chosen to avoid interfering with the catalytic activity or membrane insertion of the protease .

  • Expression system selection: While bacterial expression systems are often used for soluble proteins, membrane proteins like RHBDL2 typically require eukaryotic expression systems. HEK293 cells have been successfully used for RHBDL2 expression in previous studies .

  • Controls for functional assessment: When expressing RHBDL2, it is essential to include catalytically inactive mutants (such as mutations in the catalytic serine or histidine residues) as negative controls to confirm that any observed proteolytic activity is specifically due to RHBDL2 rather than other cellular proteases .

How can researchers accurately measure RHBDL2 proteolytic activity in vitro and in cellular systems?

Accurate measurement of RHBDL2 proteolytic activity requires careful experimental design and appropriate controls:

In cellular systems:

  • Co-expression assays: The most common approach involves co-transfecting cells with RHBDL2 and a substrate protein tagged at both N- and C-termini with different epitopes. Western blotting can then detect both the full-length substrate and the cleaved products .

  • Quantification method: The ratio of cleaved to uncleaved substrate (N/P ratio) provides a reliable measure of proteolytic activity. In wild-type cells, studies with model substrates have shown N/P ratios of approximately 4-5 for active RHBDL2/Rbd2 .

  • Essential controls:

    • Catalytically inactive RHBDL2 mutants (e.g., S130A or H182A substitutions based on yeast Rbd2 studies)

    • Cells lacking RHBDL2 expression

    • Positive controls using established substrates like TatA variants

For in vitro analysis:

  • Reconstitution in proteoliposomes or detergent micelles

  • Use of fluorogenic peptide substrates spanning the predicted cleavage sites

  • Mass spectrometry validation of cleavage products to confirm the exact cleavage sites

What are the key considerations for designing site-directed mutagenesis experiments to study RHBDL2 function?

When designing site-directed mutagenesis experiments to study RHBDL2 function, researchers should consider:

How can researchers address the challenge of substrate identification for RHBDL2?

Identifying physiological substrates of RHBDL2 presents significant challenges. Researchers can employ the following strategies:

  • Bioinformatic prediction: Screen for membrane proteins containing potential cleavage sites based on known RHBDL2 substrate preferences, particularly focusing on transmembrane domains with large hydrophobic residues followed by smaller ones at potential cleavage sites .

  • Proteomics approaches:

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) comparing the secretome of cells expressing active versus catalytically inactive RHBDL2

    • TAILS (Terminal Amine Isotopic Labeling of Substrates) to identify specific N-termini generated by RHBDL2 cleavage

    • Cell surface biotinylation followed by mass spectrometry to identify membrane proteins released upon RHBDL2 expression

  • Candidate approach: Test proteins involved in signaling pathways where RHBDL2 function has been implicated, focusing on membrane-bound growth factors and receptors similar to the established substrates ephrin B2 and B3 .

  • Validation experiments: Confirm direct cleavage by RHBDL2 through:

    • In vitro cleavage assays with purified components

    • Site-directed mutagenesis of predicted cleavage sites

    • Mass spectrometry identification of exact cleavage locations

    • Demonstration of cleavage dependence on RHBDL2 catalytic activity

What statistical considerations should be addressed when designing RHBDL2 functional studies?

Proper statistical design is crucial for valid RHBDL2 research. Key considerations include:

  • Sample size determination: Calculate appropriate sample sizes based on expected effect sizes before beginning experiments. Underpowered studies may fail to detect significant effects, while overpowered studies waste resources .

  • Addressing clustering and repeated measures: When collecting multiple measurements from the same samples or cells across time, use statistical methods that account for data dependence, such as mixed-effects models, rather than treating observations as independent .

  • Protocol adherence and preregistration: Develop a detailed statistical analysis plan before conducting experiments and adhere to it to avoid p-hacking or post-hoc analysis changes. Consider preregistering study protocols when appropriate .

  • Handling missing data: Develop strategies to address potential missing data during experimental planning rather than after data collection. Methods such as multiple imputation or maximum likelihood estimation are preferable to complete-case analysis, which can introduce bias .

  • Appropriate controls and replication: Include both positive controls (known RHBDL2 substrates) and negative controls (catalytically inactive mutants), and ensure sufficient biological replicates to establish reliability .

How can researchers investigate the structural basis of RHBDL2 substrate specificity?

Investigating the structural basis of RHBDL2 substrate specificity requires a multifaceted approach:

  • Homology modeling and molecular dynamics simulations: Using structural data from related rhomboid proteases to predict RHBDL2 structure and simulate substrate interactions, focusing on the unique ability to cleave after large hydrophobic residues .

  • Systematic substrate mutagenesis: Create a library of substrate variants with systematic mutations around the cleavage site to map the sequence determinants of RHBDL2 recognition, similar to the experiments that identified enhanced cleavage of the TatA A8L mutant .

  • Chimeric proteins and domain swapping: Exchange domains between RHBDL2 and other rhomboid proteases with different substrate specificities to identify regions responsible for the unique cleavage properties.

  • Crosslinking and co-crystallization approaches: Attempt to trap enzyme-substrate complexes using catalytically inactive RHBDL2 mutants and modified substrates designed to form stable interactions.

  • Hydrogen-deuterium exchange mass spectrometry: Map protease-substrate interaction surfaces by analyzing the differential solvent accessibility of regions in the presence or absence of the binding partner.

This systematic approach can reveal the structural determinants underlying RHBDL2's unique substrate specificity, particularly its ability to cleave after large hydrophobic residues—a property not observed in other rhomboid proteases .

How should researchers interpret discrepancies between in vitro and cellular RHBDL2 activity data?

When faced with discrepancies between in vitro and cellular RHBDL2 activity data, researchers should consider several factors:

  • Membrane environment differences: RHBDL2 is an intramembrane protease whose activity is highly dependent on the lipid environment. In vitro reconstitution systems may lack the specific lipid composition found in the Golgi apparatus where RHBDL2 naturally functions .

  • Missing cofactors or regulators: Cellular systems may contain additional proteins that regulate RHBDL2 activity. For example, the Dsc E3 ligase machinery has been shown to be required for the function of some rhomboid proteases in certain contexts .

  • Post-translational modifications: RHBDL2 may undergo cellular modifications that affect its activity and are absent in recombinant systems.

  • Substrate presentation differences: In cells, substrates may be presented to RHBDL2 in specific conformations facilitated by the cellular trafficking machinery.

To address these discrepancies, researchers should:

  • Correlate activity measurements with proper localization analysis

  • Examine the effects of lipid composition on in vitro activity

  • Consider using cell membrane extracts rather than purified components

  • Validate findings using multiple substrates and experimental approaches

What are common pitfalls in RHBDL2 research and how can they be avoided?

Common pitfalls in RHBDL2 research include:

  • Low expression levels: Standard expression systems often yield inadequate RHBDL2 protein levels. Solution: Use codon-optimized constructs, which have been shown to increase expression by >35-fold in human cells .

  • Misinterpretation of negative results: Lack of observed cleavage may result from improper protein folding or localization rather than absence of substrate recognition. Solution: Include positive controls for RHBDL2 activity in each experiment and verify proper expression and localization.

  • Overlooking alternative cleavage sites: RHBDL2 may cleave substrates at multiple sites, especially when primary sites are mutated. Solution: Always verify cleavage products by mass spectrometry rather than relying solely on gel mobility shifts .

  • Incomplete analysis of mutant effects: Mutations might appear to block cleavage when they actually shift the cleavage site to a new location. Solution: Perform comprehensive analysis of cleavage products using mass spectrometry to determine precise cleavage locations .

  • Statistical analysis inconsistencies: Using statistical methods inappropriate for the experimental design. Solution: Ensure statistical methods match the study design and develop a statistical analysis plan during protocol development .

How can researchers validate that their recombinant RHBDL2 preparation maintains native structure and function?

Validating the native structure and function of recombinant RHBDL2 requires multiple complementary approaches:

A comprehensive validation approach using these methods will ensure that experimental findings with recombinant RHBDL2 accurately reflect the native properties of this important intramembrane protease.

What are promising approaches for developing specific inhibitors or modulators of RHBDL2 activity?

Developing specific inhibitors or modulators of RHBDL2 represents an important frontier in research. Promising approaches include:

  • Structure-based drug design: Using homology models based on crystal structures of related rhomboid proteases to design compounds that selectively target RHBDL2's active site, particularly exploiting its unique ability to accommodate large hydrophobic residues near the cleavage site .

  • Substrate-derived peptide inhibitors: Developing peptide mimetics based on the transmembrane segments of known RHBDL2 substrates, incorporating non-cleavable isosteres at the scissile bond position.

  • Allosteric modulators: Targeting non-catalytic regions unique to RHBDL2 that may regulate its activity or substrate recognition, potentially offering greater selectivity over other rhomboid proteases.

  • High-throughput screening approaches: Utilizing cell-based assays with fluorescent or luminescent readouts to screen compound libraries for molecules that modulate RHBDL2 activity.

  • Antibody-based inhibitors: Developing single-domain antibodies or nanobodies that can access the active site or regulatory domains of RHBDL2 within the membrane environment.

How might RHBDL2 function be investigated in the context of tissue-specific or developmental regulation?

Investigating RHBDL2 in tissue-specific or developmental contexts requires specialized approaches:

  • Conditional knockout models: Developing tissue-specific or temporally controlled RHBDL2 knockout models using Cre-lox or similar systems to assess function in specific tissues or developmental stages without the confounding effects of germline deletion.

  • Single-cell analysis: Employing single-cell RNA-seq or proteomics to characterize RHBDL2 expression patterns and correlate them with potential substrate availability across different cell types within complex tissues.

  • Organoid models: Utilizing 3D organoid cultures derived from different tissues to study RHBDL2 function in near-physiological contexts that maintain tissue architecture and cellular differentiation states.

  • In vivo substrate trapping: Developing catalytically inactive RHBDL2 variants that can stably bind substrates without cleaving them, then identifying these interaction partners in specific tissues or developmental stages.

  • Lineage tracing combined with RHBDL2 modulation: Using genetic lineage tracing approaches in conjunction with RHBDL2 manipulation to determine how this protease influences cell fate decisions during development.

What technological advances could address current limitations in studying intramembrane proteases like RHBDL2?

Several emerging technologies hold promise for overcoming current limitations in RHBDL2 research:

  • Cryo-electron microscopy advancements: Continued improvements in cryo-EM technology may soon allow direct structural determination of RHBDL2 within native-like membrane environments, potentially revealing the molecular basis of its unique substrate specificity .

  • Advanced membrane mimetics: Development of new membrane mimetic systems that better recapitulate the complex lipid environment of the Golgi apparatus, where RHBDL2 naturally functions, could improve in vitro activity assays and structural studies.

  • Genome editing technologies: CRISPR-based approaches for introducing precise mutations or tags into endogenous RHBDL2 would allow study of the protein at physiological expression levels without overexpression artifacts.

  • Proximity labeling methods: Techniques such as TurboID or APEX2 fused to RHBDL2 could identify proteins in close proximity to the protease in living cells, potentially revealing novel substrates and regulatory partners.

  • Integrative structural biology: Combining multiple structural techniques (X-ray crystallography, NMR, cryo-EM, crosslinking mass spectrometry) with computational modeling to generate comprehensive structural models of RHBDL2-substrate complexes.

  • Microfluidic enzyme assays: Development of microfluidic systems for analyzing RHBDL2 activity in defined membrane environments with precise control over lipid composition, pH, and other factors that influence protease function.

These technological advances will likely transform our understanding of RHBDL2 biology and facilitate the development of specific modulators for research and potentially therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.