Recombinant Rhomboid-like protease 4 (ROM4)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Host Cell Invasion

ROM4 is essential for optimizing T. gondii invasion efficiency:

  • Adhesin Processing: Cleaves MIC2 and AMA1 to establish an apical-to-posterior adhesin gradient, enabling proper orientation for host cell penetration .

  • Motility and Attachment:

    • Wild Type (WT): Exhibits helical gliding motility and productive attachment.

    • Δrom4 Mutants: Show reduced gliding, increased twirling, and nonproductive attachment due to adhesin accumulation .

Experimental Evidence

AssayWTΔrom4Δrom1 Δrom4 Δrom5
Invasion EfficiencyHigh (80–100%)Reduced (40–60%)Further reduced
Plaque FormationNormalSmaller plaques40–60% smaller plaques
In Vivo SurvivalComparable to WTUnaffectedUnaffected

Comparative Analysis with Other ROMs

ROM4’s role is distinct from other T. gondii rhomboid proteases:

ProteaseLocalizationActivity in TachyzoitesRole in Invasion
ROM4Plasma membraneHigh (primary adhesin cleavage)Critical for motility and invasion
ROM5Posterior endLow (robust in vitro)Negligible role
ROM1MicronemesMinimalNo observable effect

Redundancy and Compensation

  • Δrom4 Mutants: MIC2 accumulates on the surface but is removed via ROM-independent mechanisms during active invasion .

  • Triple Knockout (Δrom1 Δrom4 Δrom5): Survives in vitro and in vivo, indicating non-essentiality despite reduced efficiency .

Cross-Species Insights: ROM4 in Babesia bovis

In B. bovis, ROM4 paralogs (ROM4.1–ROM4.5) exhibit stage-specific expression:

  • Sexual Stages (SS): rom4.1 and rom4.3/4.4 show 18- and 218-fold higher transcription compared to asexual stages (AS) .

  • Polymorphisms: Geographic isolates differ primarily in tandem repeats of a 29-amino acid sequence in ROM4.5, potentially influencing antigenicity .

Research Implications and Future Directions

  1. Therapeutic Targeting: ROM4’s role in invasion highlights it as a candidate for antiparasitic drug development.

  2. Stage-Specific Functions: ROM4’s expression in B. bovis sexual stages suggests roles beyond erythrocyte invasion, such as tick-stage processes .

  3. Mechanistic Studies: Elucidating ROM-independent adhesin removal pathways could reveal novel invasion strategies.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a useful reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C. Lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its incorporation.
Synonyms
ROM4; Rhomboid-like protease 4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-641
Protein Length
full length protein
Species
Toxoplasma gondii
Target Names
ROM4
Target Protein Sequence
MVWTSAVVMASPHGSASRAGSNRRTDGLSVNLGQDNTLKHDTPTETAPSASPPRVAPAPI PPKGGPAATPGKDGALDNRGSHDSVPPVAVAIPGREEVNATASQKSVVAGANSQPTPGTQ SSKAPASDVDGSSKHGSPEHPDAGSPEVNAEGVPVEEALQAIGDDDPLIHNLPDGVVGRR APANPFNSSMYAKLRGKKKKHRPKVRDPKLNNNPLRGRLVVCISTTALLCWIYMWELIYN FTSFNGRCVSPVMYPDYKLQEAKQRQPYVIRYGYGGCEYNLGSLAYPRASFGTSAGDKGW PVDLVPNGSAGSAATSWDSPNARVLRHLGGLETNYIREYSETFRLFTSMYMHGGWLHILI NLSCQIQILWIIEPDWGFLRTTLLFFLGGISGNLLSAVADPCSITVGSSGSMYALLGALI PYCVEYWKSIPRPGCILVFMIVVIIGILTGMAGFTDNYAHMGGALGGILWGFASITTVSA CDKCTLGERMAMTPPFSWCVPKATQQKLLERAKARKAEAIRRRKLQAIQKKKAGGARGKA MYAVKMRLQEEGRPPCKMSFREWVIRGLCAAALFAYWLILFLYLLDPSLYKSYSPPGQLK FSGWLYCKCGTIVYQAPQTYGNLGRFWCFGSEKDAQYYLEP
Uniprot No.

Target Background

Function
Recombinant Rhomboid-like protease 4 (ROM4) is a putative serine protease involved in intramembrane proteolysis, facilitating the release of polypeptides from their membrane anchors.
Protein Families
Peptidase S54 family
Subcellular Location
Membrane; Multi-pass membrane protein. Note=Uniformly distributed at the surface of intracellular and extracellular tachyzoites.

Q&A

What is Rhomboid-like Protease 4 (ROM4) and what are its primary biological roles?

ROM4 belongs to the rhomboid family of intramembrane serine proteases that cleave transmembrane substrates within lipid bilayers. These enzymes play diverse biological roles including growth factor signaling, immune and inflammatory responses, protein quality control, and in parasitic organisms, they facilitate invasion mechanisms. In Toxoplasma gondii, TgROM4 specifically affects the processing of surface adhesins essential for host cell invasion by apicomplexan parasites . The human homolog RHBDL4 demonstrates a critical function in removing misfolded proteins from the endoplasmic reticulum .

How does ROM4 differ structurally and functionally from other rhomboid proteases?

ROM4 shares the core catalytic mechanism of rhomboid proteases but exhibits distinct substrate preferences and biological functions depending on the organism. While bacterial rhomboid proteases have been extensively characterized, eukaryotic ROM4 and its homologs demonstrate specialized functions in protein quality control and cell-cell interactions. In parasites like T. gondii, ROM4 specifically processes surface adhesins, distinguishing it functionally from other rhomboid family members .

What expression systems are most effective for producing recombinant ROM4?

For studying TgROM4, researchers have successfully employed conditional expression systems using Tet-transactivator technology. This approach involves creating a merodiploid clone by transfecting an HA9-epitope tagged copy of TgROM4 into a T. gondii line expressing the Tet-transactivator, allowing for controlled expression . For related rhomboid proteases like RHBDL4, recombinant expression and purification systems have been developed that can likely be adapted for ROM4 studies as well .

What are the optimal conditions for assessing ROM4 enzymatic activity in vitro?

Based on studies with the related human rhomboid protease RHBDL4, optimal conditions typically include a salt concentration range of 100-300 mM, with highest activity occurring at pH 8 . When developing an in vitro platform for rhomboid proteases, temperature stability and detergent selection are also critical factors. The development of Förster Resonance Energy Transfer (FRET)-based cleavage assays has proven particularly valuable for characterizing kinetics, catalytic parameters, and substrate specificity .

What structural motifs are essential for ROM4 catalytic function?

Research on related rhomboid proteases has identified several critical structural elements. The conserved WR motif in the L1 region is required for proteolytic activity. Interestingly, studies with RHBDL4 demonstrate that while the WR motif is essential, mutations in the conserved Gx₃G motif did not eliminate proteolytic activity in vitro . These findings may provide insight into structural requirements for ROM4 function across species.

How can substrate specificity of ROM4 be determined experimentally?

Substrate specificity for rhomboid proteases can be characterized using FRET-based cleavage assays with synthetic peptide substrates containing systematic variations at key positions. Studies with RHBDL4 reveal a preference for small amino acids at the P1 position within substrates, similar to other characterized rhomboid proteases . Computational approaches including ensemble docking and molecular dynamics simulations can complement experimental data by identifying key interactions within the active site .

What approaches can overcome challenges in generating ROM4 knockouts?

When conventional gene disruption by double homologous recombination proves unsuccessful, as experienced with TgROM4, alternative strategies become necessary. A conditional knockout approach using a Tet-transactivator system has proven effective . This strategy involves:

  • Creating a merodiploid expressing an epitope-tagged copy of the gene

  • Using anhydrotetracycline (Atc) to suppress expression

  • Monitoring the resulting phenotype under controlled conditions

This approach allows researchers to study essential genes that cannot be directly disrupted through conventional knockout techniques .

How can researchers develop effective inhibitors targeting ROM4?

Development of ROM4 inhibitors follows a structure-guided approach that can be adapted from successful strategies with related rhomboid proteases:

  • Use substrate cleavage recognition sequences as templates

  • Develop peptidyl α-ketoamide derivatives that interact with the active site

  • Apply ensemble docking and molecular dynamics simulations to optimize binding modality

  • Test inhibitor efficacy using in vitro FRET-based cleavage assays

Studies with RHBDL4 have successfully identified peptidyl α-ketoamide inhibitors using this methodological framework .

What evidence links ROM4 activity to disease pathways?

The human rhomboid protease RHBDL4, which shares functional similarities with ROM4, has been implicated in several serious diseases including various cancers and Alzheimer's disease . Its role in removing misfolded proteins from the endoplasmic reticulum positions it as a key regulator of protein quality control, with dysfunction potentially contributing to neurodegenerative and malignant conditions. In parasitic contexts, ROM4 facilitates infection processes essential for pathogenesis .

How can ROM4 be targeted therapeutically in different disease contexts?

The therapeutic targeting of ROM4 depends on the disease context. For parasitic infections, inhibiting ROM4 could disrupt the shedding of surface adhesins necessary for host cell invasion . For conditions involving protein quality control like those associated with RHBDL4, modulating activity rather than complete inhibition might be preferable. The development of in vitro platforms for screening inhibitors provides a foundation for identifying lead compounds that can be optimized for specific clinical applications .

What are the characteristic catalytic rates of ROM4 and how do they compare to other proteases?

Rhomboid proteases generally exhibit relatively slow catalytic rates compared to many other proteases. Studies with RHBDL4 revealed a cleavage rate of approximately 11 substrates per hour, similar to other rhomboid proteases like GlpG and PARL . This slow catalytic rate has important implications for experimental design, requiring extended incubation times and highly sensitive detection methods when assessing activity.

How should researchers interpret kinetic data from ROM4 enzymatic assays?

When analyzing ROM4 kinetic data, researchers should consider:

  • The inherently slow catalytic rate of rhomboid proteases

  • The influence of detergent and lipid environment on activity

  • The potential for substrate-dependent variations in cleavage efficiency

  • The importance of comparing relative rates across multiple experimental conditions

The development of standardized FRET-based assays provides a quantitative framework for these analyses .

What are the most promising avenues for advancing ROM4 research?

Based on current knowledge gaps and technological developments, several promising research directions emerge:

  • Comprehensive characterization of ROM4 substrate profiles across different organisms

  • Development of more selective inhibitors for specific rhomboid family members

  • Investigation of ROM4's role in protein quality control networks

  • Exploration of structure-function relationships through advanced crystallography and cryo-EM approaches

  • Application of genome editing technologies to study ROM4 in diverse model systems

The development of improved in vitro platforms will facilitate these research directions by enabling more detailed enzymatic characterization .

What technological advances might enhance ROM4 research?

Several technological advances show particular promise for ROM4 research:

  • Improved recombinant expression systems for membrane proteins

  • Advanced computational methods for predicting substrate specificity

  • High-throughput screening platforms for inhibitor discovery

  • Live-cell imaging techniques to monitor ROM4 activity in real-time

  • Proteomics approaches to identify physiological substrates

These technological developments will help address fundamental questions about ROM4 function while facilitating translational applications .

How does ROM4 function differ between parasitic organisms and mammals?

In parasitic organisms like Toxoplasma gondii, ROM4 plays a specialized role in processing surface adhesins critical for host cell invasion . In contrast, mammalian homologs like RHBDL4 function primarily in protein quality control within the endoplasmic reticulum . These functional differences reflect evolutionary adaptations to distinct biological needs while maintaining the core catalytic mechanism characteristic of rhomboid proteases.

What experimental approaches can elucidate ROM4 evolutionary relationships?

Comparative genomics combined with functional assays can reveal evolutionary relationships between ROM4 variants across species. Sequence analysis of conserved motifs like the WR region and Gx₃G motif, coupled with substrate specificity profiling, can identify conserved and divergent features . Conditional expression systems used successfully for TgROM4 can be adapted to study orthologs in diverse organisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.