Recombinant Rhomboid protease AarA (aarA)

Shipped with Ice Packs
In Stock

Description

Biological Function of AarA

AarA is a conserved rhomboid protease that regulates intercellular communication in Providencia stuartii by processing the TatA component of the twin-arginine translocase (Tat) system . This cleavage event activates secreted quorum-sensing signals, enabling bacterial populations to coordinate gene expression based on cell density . AarA’s substrate specificity and enzymatic activity are evolutionarily conserved, with functional overlap observed in Drosophila rhomboid homologs .

Recombinant Expression and Purification

Recombinant AarA is produced in Escherichia coli using a pBAD expression system . Key steps include:

  • Expression: Induced with 0.002%–0.2% L-arabinose at 25°C for 16–20 hours.

  • Purification: Sequential use of immobilized metal affinity chromatography (IMAC) and size-exclusion chromatography (SEC) yields 1–2.5 mg/L of purified enzyme .

  • Detergent stabilization: Maintained in 0.1% DDM (n-dodecyl-β-D-maltopyranoside) or 0.2% DM (decyl maltoside) .

Table 2: Kinetic Parameters of psTatA Cleavage

ProteaseK<sub>0.5</sub> (μM)k<sub>cat</sub> (min<sup>−1</sup>)h (Hill Coefficient)
AarA1.38 ± 0.101.06 ± 0.051.70 ± 0.18
ecGlpG1.25 ± 0.150.39 ± 0.021.20 ± 0.10
hiGlpG5.10 ± 0.500.21 ± 0.012.10 ± 0.10

Research Applications

  • Quorum-sensing studies: Used to dissect signaling pathways in Providencia stuartii and related pathogens .

  • Intramembrane protease mechanisms: Serves as a model enzyme for studying substrate specificity, cooperativity, and allosteric regulation in lipid bilayers .

  • Therapeutic potential: Insights into AarA’s role in antibiotic resistance and bacterial communication may inform antimicrobial strategies .

Challenges and Controversies

  • Substrate specificity: While AarA cleaves psTatA efficiently, its broad substrate recognition in heterologous systems (e.g., Drosophila Spitz) remains mechanistically unresolved .

  • Expression variability: Yields depend heavily on induction conditions and detergent selection, complicating large-scale production .

Future Directions

  • Structural studies: High-resolution cryo-EM or crystallography to map exosite-substrate interactions.

  • Allosteric inhibitors: Development of compounds targeting dimerization or exosite binding to disrupt quorum sensing .

  • Biomedical engineering: Leveraging AarA’s cleavage specificity for synthetic biology applications .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order. We will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, and additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the stability of the protein itself.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
aarA; Rhomboid protease AarA; Intramembrane serine protease
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-281
Protein Length
full length protein
Species
Providencia stuartii
Target Names
aarA
Target Protein Sequence
MAEQQNPFSIKSKARFSLGAIALTLTLVLLNIAVYFYQIVFASPLDSRESNLILFGANIY QLSLTGDWWRYPISMMLHSNGTHLAFNCLALFVIGIGCERAYGKFKLLAIYIISGIGAAL FSAYWQYYEISNSDLWTDSTVYITIGVGASGAIMGIAAASVIYLIKVVINKPNPHPVIQR RQKYQLYNLIAMIALTLINGLQSGVDNAAHIGGAIIGALISIAYILVPHKLRVANLCITV IAASLLTMMIYLYSFSTNKHLLEEREFIYQEVYTELADANQ
Uniprot No.

Target Background

Function
Rhomboid serine protease that catalyzes intramembrane proteolysis. It mediates quorum-sensing and the subsequent regulation of target genes through activation of the Tat protein export system. It catalyzes the proteolytic activation of TatA by removing its N-terminal extension.
Database Links
Protein Families
Peptidase S54 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is rhomboid protease AarA and what organism does it originate from?

AarA is a rhomboid family intramembrane serine protease that originates from the bacterium Providencia stuartii. It represents an important model for studying intramembrane proteolysis mechanisms. AarA has seven predicted transmembrane domains and reflects the topology found in the eukaryotic secretory class of rhomboids, distinguishing it from other bacterial rhomboids that typically have six transmembrane domains .

What is the primary physiological substrate of AarA?

The primary physiological substrate of AarA is psTatA (TatA from Providencia stuartii). Notably, AarA-psTatA represents the only known physiological enzyme-substrate pair in prokaryotic rhomboid systems, making it a valuable model for studying native rhomboid function . The specificity of this interaction has been demonstrated through various kinetic assays, showing significant differences in catalytic efficiency between AarA and other rhomboids when cleaving this substrate .

What expression systems are typically used for recombinant AarA production?

Recombinant AarA can be expressed in several systems, with bacterial and yeast expression being most common. For functional studies, researchers have successfully expressed AarA in E. coli for in vitro studies . Human PARL (a related rhomboid protease) has been expressed in yeast systems, suggesting this could be applied to AarA as well . When expressing recombinant AarA, researchers should be aware that incomplete deformylation of the initiator N-formylmethionine by peptide deformylase can occur, though this doesn't appear to influence rhomboid cleavage kinetics .

What assays can be used to measure AarA proteolytic activity?

Several complementary approaches have been developed to measure AarA activity:

  • Gel-based assays: Western blot analysis using anti-His antibodies can detect substrate cleavage products .

  • FRET-based kinetic assays: Real-time monitoring of AarA activity using engineered substrates like CyPet-psTatA-YPet. This approach requires careful optimization to avoid signal cross-contamination .

  • Mass spectrometry-based assays: MALDI-MS can monitor the ratio of intact substrate to cleavage product. This method has been shown to be sensitive and robust with a high Z'-score of 0.82, making it suitable for inhibitor screening .

How should FRET-based assays be optimized for studying AarA activity?

For FRET-based kinetic assays, researchers should:

  • Optimize enzyme concentration to ensure linear product formation over time

  • Determine optimal detergent concentration to prevent non-specific aggregation

  • Verify that measurements are obtained during the initial rate phase

  • Establish a linear relationship between time and product formation

  • Use modified methods to account for auto-fluorescence to avoid signal cross-contamination

  • Set the pH to the optimal range (pH 5.7-6.5)

What are the optimal buffer conditions for AarA activity assays?

Based on experimental data, the following conditions are optimal for AarA activity:

ParameterOptimal ConditionNotes
pH5.7-6.5Slightly acidic range, unlike most serine proteases which prefer pH 8-11
Buffer50 mM MES pH 6.0Standard buffer used in published assays
Salt150 mM NaClMaintains protein stability
Temperature37°CStandard incubation temperature
Detergent0.1% DDM or 0.2% DMPrevents non-specific aggregation
Glycerol20%Enhances stability

What are the kinetic parameters of AarA-mediated proteolysis?

AarA exhibits distinct kinetic properties when cleaving its physiological substrate psTatA:

ParameterValueComparison to Other Rhomboids
Turnover rate (kcat)1.06 ± 0.05 min^-1Faster than ecGlpG and hiGlpG
K0.5Higher than ecGlpG, lower than hiGlpGIndicates moderate substrate affinity
Hill's coefficient (h)1.70 ± 0.18Shows positive cooperativity, between ecGlpG (1.2 ± 0.1) and hiGlpG (2.1 ± 0.1)

These parameters reveal that AarA cleaves its physiological substrate more efficiently than other bacterial rhomboids, with significant positive cooperativity in substrate binding .

How does AarA's substrate specificity compare to other rhomboid proteases?

AarA shows specific recognition of the psTatA substrate. This specificity is demonstrated through:

  • Higher catalytic efficiency (kcat/K0.5) compared to ecGlpG and hiGlpG for psTatA cleavage

  • Ability to cleave FRET-TatA substrate, which ecGlpG and hiGlpG cannot process

  • Distinct recognition mechanism that exists between the AarA-psTatA physiological pair

This specificity suggests that rhomboids are not merely broad-specificity enzymes but have evolved distinct substrate preferences.

What is the oligomeric state of AarA and how does it affect function?

AarA exists as a dimer in the lipid bilayer. This dimerization is functionally significant as:

  • The dimer contains both an active site and an exosite

  • When dimers are dissociated, allosteric substrate activation is not observed

  • Dimerization appears important for transmembrane substrate cleavage

  • Soluble model substrates (like casein) can be cleaved by both dimers and monomers in a non-cooperative manner

These findings indicate that the oligomeric state of AarA is critical for its physiological function, particularly for the allosteric regulation of substrate cleavage.

What is the mechanism of allosteric regulation in AarA?

AarA exhibits homotropic allosteric activation by its substrate. Key aspects of this mechanism include:

  • Positive cooperativity in substrate binding, indicated by sigmoidal kinetics and Hill coefficients >1

  • The presence of an exosite distinct from the catalytic site

  • Substrate binding to both the exosite and catalytic site (homotropic allosterism)

  • Dependence on the dimeric state of the enzyme

  • Conformational changes upon substrate binding

This allosteric regulation represents an efficient mechanism to modulate and regulate AarA activity, preventing non-specific substrate cleavage by altering substrate accessibility and affinity.

How does the structure of AarA compare to other rhomboid proteases?

AarA has seven predicted transmembrane domains, which distinguishes it from bacterial forms like hiGlpG (six transmembrane helices) and ecGlpG (six transmembrane core with a cytoplasmic domain). This topology is more similar to the eukaryotic secretory class of rhomboids, suggesting AarA may serve as a better model for studying certain aspects of eukaryotic rhomboid function .

What types of inhibitors are effective against AarA?

Isocoumarin-based inhibitors have been identified as effective against rhomboid proteases including AarA. These inhibitors:

  • Bind covalently but reversibly to the active-site serine

  • Stably modify a histidine residue in the active site

  • Can distinguish between active and inactive rhomboids

  • Provide a framework for rational design of more specific inhibitors

How can activity-based probes be utilized to study AarA?

Activity-based probes (ABPs) for rhomboid proteases:

  • Are based on the isocoumarin reactive group

  • Label only active rhomboids through covalent modification

  • Can be used in activity-based profiling to distinguish between active and inactive enzymes

  • Allow visualization of active enzyme pools in complex biological samples

  • Provide structural insights into the mode of inhibitor binding at the active site

These probes represent valuable tools for studying the activity and regulation of AarA in various experimental contexts.

What is the optimal approach for screening inhibitors against AarA?

An effective inhibitor screening approach for AarA involves:

  • Using the MALDI-MS-based endpoint assay where the enzyme is first treated with potential inhibitors and then incubated with substrate

  • Measuring the percentage of residual substrate as an indicator of inhibition

  • Including appropriate positive controls (AarA active-site mutant S150A) and negative controls (wild-type AarA)

  • Calculating the Z'-factor to assess assay quality (reported value of 0.82 indicates a robust assay)

  • Focusing on compounds with reactive electrophiles known to modify active-site residues of serine proteases

How do lipid composition and environment affect AarA activity?

The lipid environment significantly impacts AarA activity. For related rhomboid proteases, cardiolipin has been shown to enhance activity in detergent solutions. Higher turnover rates are observed when the enzyme is reconstituted in proteoliposomes compared to detergent micelles, suggesting that the lipid bilayer provides a more native-like environment that promotes optimal enzyme function .

What computational approaches can be used to predict and design AarA substrate specificity?

Advanced computational approaches for studying rhomboid proteases include:

  • Supervised machine learning methods incorporating energetic terms from protease-substrate interfaces

  • Protease Specificity Prediction and Design using Graph Convolutional Networks (PGCN)

  • Models that can identify important intermolecular interactions determining specificity

  • Computational design processes that propose sequences with stabilizing interactions with target substrates

These approaches could potentially be applied to AarA to better understand and potentially engineer its substrate specificity.

How can FRET substrates be designed to optimize AarA activity measurements?

For optimal FRET-based measurement of AarA activity, researchers should consider:

  • Using fluorescent protein pairs like CyPet-YPet that provide good spectral separation

  • Incorporating the full physiological substrate sequence (psTatA) between the fluorophores

  • Optimizing linker regions to maintain substrate accessibility while preserving FRET efficiency

  • Validating that the FRET substrate behaves similarly to the native substrate

  • Using modified data analysis methods to account for auto-fluorescence and avoid signal cross-contamination

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.