Recombinant Rhomboid-related protein 1 (rom-1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery time estimates.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
rom-1; F26F4.3; Rhomboid-related protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-356
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
rom-1
Target Protein Sequence
MFSSEGKFRKTYRHQFNQLRTGDETEIPMSTLASRIETRKIPLTNGQIHAIKEAPDELVD IDGFQKIVTSKAAQRSTIKRIMYDMADPIMSDSQKIEVHSYIDSYSWCPPPIFMLLITII QVGIFFFYWESDGGRSIWTDCAGCFVHHNHTAPGIFIFAPKLRGEAWRFTSYMFLHAGLN HLLGNVIIQLLVGIPLEVAHKIWRIGPIYLLAVTSGSLLQYAIDPNSLLVGASAGVYALI FAHVANVILNWHEMPLRWIRVLVLFVFIFLDFGGAIHRRFYTNDCDSVSHLAHIAGAVTG LFFGYVVLYNVVEHRIEKIIRYVCLFLYSAFFATTIIFVIVRQPYSKNLWNNENCS
Uniprot No.

Target Background

Function
Recombinant Rhomboid-related protein 1 (ROM-1) is a serine protease that activates the lin-3 isoform a in the proximal vulva precursor cells (VPC) during vulva development. This activation transmits the inductive anchor cell signal to the distal VPCs.
Gene References Into Functions
  1. ROM-1 acts as a positive regulator of the EGFR/RAS/MAPK signaling pathway during vulval induction. PMID: 15455032
  2. ROM-1 and ROM-2 play a conserved role in activating EGFR signaling in C. elegans. PMID: 15455032
Database Links

KEGG: cel:CELE_F26F4.3

STRING: 6239.F26F4.3

UniGene: Cel.25302

Protein Families
Peptidase S54 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the structural relationship between ROM1 and PRPH2 in photoreceptor disc formation?

ROM1 and PRPH2 (peripherin-2) are homologous tetraspanin proteins that together form the molecular building blocks of photoreceptor disc rims. Within the disc rim, these proteins form both homo- and heteromeric complexes that are assembled into larger oligomers connected by disulfide bonds . Research has revealed that three parallel interconnected chains of these oligomers wrap around the circumference of mature discs, supporting their characteristic hairpin-shaped structure .

While structurally homologous, ROM1 appears to play a redundant but complementary role to PRPH2. Recent studies demonstrate that ROM1 knockout causes a compensatory increase in the disc content of PRPH2, suggesting a regulatory relationship between these proteins . Despite this compensation, discs lacking ROM1 display distinct morphological abnormalities including delayed enclosure, increased diameter, and absence of incisures .

How does ROM1 deficiency affect photoreceptor morphology?

ROM1 deficiency produces several distinct morphological changes in photoreceptor cells:

  • Delayed disc enclosure: ROM1-knockout (Rom1-/-) rods show approximately twice as many open discs (~14) as wild-type rods (~7) at the base of outer segments .

  • Increased variability: The number of open discs in Rom1-/- rods shows much greater variability than in wild-type, occasionally reaching up to ~30 open discs .

  • Increased outer segment diameter: Rom1-/- rods exhibit outer segments approximately 35% wider than wild-type rods .

  • Absence of incisures: Normal mouse discs contain a single deep indentation (incisure) in their rims, which is completely absent in Rom1-/- discs .

This morphological profile suggests that while ROM1 is not essential for basic disc formation, it plays important roles in disc maturation, size regulation, and specialized structural features.

What compensatory mechanisms occur in response to ROM1 deficiency?

The primary compensatory mechanism observed in ROM1 deficiency is an upregulation of PRPH2. Quantitative proteomics has shown that Rom1-/- mice exhibit a significant increase in the relative disc content of PRPH2 . This adjustment appears to be an attempt to maintain the total tetraspanin content at levels similar to wild-type discs.

Interestingly, further increasing PRPH2 levels through overexpression can rescue many of the morphological defects seen in Rom1-/- photoreceptors. This suggests that while ROM1 has specific functions in normal photoreceptor development, sufficient quantities of PRPH2 can compensate for most ROM1 functions in an experimental context .

What methodologies are most effective for studying ROM1 interactions with its binding partners?

Studying ROM1's interactions requires a multifaceted approach combining biochemical, structural, and cellular techniques:

Biochemical approaches:

  • Co-immunoprecipitation: Effectively used to identify protein-protein interactions between ROM1 and PRPH2, revealing the formation of homo- and heteromeric complexes .

  • Cross-linking studies: Useful for capturing transient or weak interactions.

  • Blue native PAGE: Particularly valuable for studying the oligomeric state of ROM1-containing complexes under non-denaturing conditions.

Structural approaches:

  • Cryogenic electron microscopy (cryo-EM): Provides insights into the three-dimensional organization of ROM1-PRPH2 complexes within disc membranes.

  • X-ray crystallography: While challenging for membrane proteins, successful crystallization of related rhomboid proteases has revealed critical structural features .

Cellular approaches:

  • CRISPR-Cas9 genome editing: Enables precise manipulation of ROM1 and partner genes to study functional relationships.

  • Quantitative proteomics: Successfully used to measure compensatory changes in protein levels, as demonstrated in Rom1-/- mice .

When designing interaction studies, researchers should consider the membrane-embedded nature of ROM1 and choose detergents and buffers that preserve native protein conformation and interactions.

How can researchers accurately assess the functional redundancy between ROM1 and PRPH2?

Assessing functional redundancy between ROM1 and PRPH2 requires systematic experimental approaches:

Recommended experimental design:

  • Genetic manipulation studies:

    • Single knockouts (Rom1-/- and Prph2-/-)

    • Double knockouts (Rom1-/-/Prph2-/-)

    • Rescue experiments with varying expression levels of each protein

    • Domain swap experiments (e.g., replacing the tetraspanin body of PRPH2 with that of ROM1)

  • Quantitative analysis of photoreceptor phenotypes:

    • Measure number of open discs using tannic acid and uranyl acetate staining

    • Determine outer segment diameter across different genetic backgrounds

    • Assess incisure formation through tangential TEM sectioning

    • Evaluate photoreceptor function through electroretinography (ERG)

  • Protein expression analysis:

    • Quantitative proteomics to determine relative abundance

    • Western blotting with phosphorylation-specific antibodies to assess activation state

    • Immunohistochemistry to examine subcellular localization

Data interpretation framework:

ParameterROM1-/-PRPH2-/-ROM1-/-/PRPH2-/-ROM1-/- with PRPH2 OE
Open discs~14 (variable)Severe defectsComplete failure~7 (normal)
OS diameter+35%ReducedAbsentNormal
IncisuresAbsentReducedAbsentPresent
FunctionMild declineSevere declineNon-functionalNear normal

This structured approach allows researchers to distinguish between shared and unique functions, as well as to quantify the degree of functional compensation possible between these proteins.

What are the critical considerations when designing experiments to study ROM1 trafficking in photoreceptor cells?

Studying ROM1 trafficking in photoreceptors presents unique challenges due to the specialized architecture of these cells and the dynamic nature of outer segment disc formation:

Key experimental considerations:

  • Temporal resolution:

    • ROM1 trafficking occurs within a narrow time window during disc formation

    • Pulse-chase experiments with metabolic labeling can track newly synthesized ROM1

    • Time-lapse imaging with photoconvertible fluorescent tags allows visualization of protein movement

  • Spatial resolution:

    • Super-resolution microscopy (STORM, PALM) can resolve ROM1 localization at different stages

    • Correlative light and electron microscopy (CLEM) combines molecular specificity with ultrastructural detail

    • Expansion microscopy can enhance resolution of conventional microscopes

  • Model system selection:

    • Mouse models provide physiological context but limited manipulation options

    • Frog or zebrafish models allow for easier visualization of larger photoreceptors

    • Cell culture systems (661W cells) offer simplified manipulation but lack authentic outer segment formation

  • Protein tagging strategies:

    • Small epitope tags (HA, FLAG) minimize functional disruption

    • Position tags at protein termini to avoid disrupting transmembrane domains

    • Validate that tagged proteins localize and function normally

Trafficking analysis methodologies:

  • Vesicle isolation: Gradient centrifugation to isolate transport vesicles containing ROM1

  • Co-localization studies: Identify trafficking partners through co-localization with vesicle markers

  • Pharmacological manipulation: Use of trafficking inhibitors (Brefeldin A, monensin) to disrupt specific pathways

  • Temperature blocks: Synchronize trafficking by temperature manipulation in cold-blooded animal models

Understanding ROM1 trafficking is essential for interpreting the phenotypes observed in ROM1 deficiency, particularly the delayed disc enclosure and altered disc morphology documented in Rom1-/- mice .

What techniques provide the most reliable quantification of ROM1-PRPH2 complex formation?

Reliable quantification of ROM1-PRPH2 complex formation requires techniques that preserve native interactions while enabling precise measurement:

Gold standard approaches:

  • Förster Resonance Energy Transfer (FRET):

    • Allows measurement of direct protein-protein interactions within 10nm

    • Can be performed in living cells or tissues

    • Requires fluorescent protein tagging or antibody labeling

    • Provides ratiometric data that can be quantified

  • Proximity Ligation Assay (PLA):

    • Detects proteins within 40nm of each other

    • Works with fixed tissue samples

    • Compatible with standard microscopy equipment

    • Provides countable interaction spots for quantification

  • Blue Native PAGE with Western Blotting:

    • Preserves native protein complexes during separation

    • Can resolve different oligomeric states

    • Allows molecular weight estimation of complexes

    • Can be quantified by densitometry

  • Quantitative Mass Spectrometry:

    • SILAC or TMT labeling enables precise ratio determination

    • Can identify both known and novel interaction partners

    • Provides unbiased whole-proteome perspective

    • Requires specialized equipment and expertise

Interpretation framework for complex formation data:

TechniqueStrengthsLimitationsBest Applications
FRETDirect interaction detection, live imagingRequires protein taggingDynamic studies, real-time monitoring
PLAWorks in tissue samples, high sensitivityCannot distinguish direct vs. indirectFixed tissue analysis, spatial mapping
Blue Native PAGEPreserves native complexes, size informationLimited to solubilized proteinsOligomeric state analysis, complex stoichiometry
Mass SpectrometryUnbiased, whole-proteomeComplex sample preparationInteraction network mapping, novel partner discovery

When reporting complex formation data, researchers should always include both positive controls (known interacting proteins) and negative controls (non-interacting proteins) to establish the specificity and sensitivity of their chosen technique.

What are the optimal approaches for modeling ROM1 function in vitro given its membrane-associated nature?

Modeling ROM1 function in vitro presents challenges due to its integral membrane nature and specialized function in photoreceptor disc formation. Several complementary approaches can overcome these limitations:

Recommended in vitro systems:

  • Liposome reconstitution:

    • Purified ROM1 can be incorporated into artificial lipid bilayers

    • Allows control over lipid composition to match photoreceptor disc membranes

    • Enables biophysical studies of membrane curvature effects

    • Can be analyzed by electron microscopy for structural studies

  • Cell-free expression systems:

    • Direct synthesis of ROM1 in the presence of supplied membranes

    • Avoids cellular trafficking complications

    • Allows incorporation of unnatural amino acids for biophysical studies

    • Compatible with subsequent structural or functional assays

  • Nanodiscs:

    • Small patches of bilayer stabilized by scaffold proteins

    • Provide a native-like membrane environment at defined size

    • Compatible with many biophysical techniques including NMR

    • Allow study of ROM1-PRPH2 interactions in a controlled system

  • Droplet interface bilayers:

    • Form membrane bilayers between aqueous droplets in oil

    • Enable electrical recordings and fluorescence microscopy

    • Allow asymmetric bilayer formation

    • Permit dynamic manipulation of membrane composition

Functional readouts for in vitro systems:

  • Membrane curvature assays: Measure ROM1's ability to induce or stabilize membrane curvature using fluorescently labeled liposomes

  • Protein-lipid interaction assays: Assess ROM1's lipid binding preferences using lipid overlay assays or liposome flotation assays

  • Oligomerization assays: Monitor complex formation using FRET, fluorescence correlation spectroscopy, or analytical ultracentrifugation

  • Structural studies: Cryo-EM of ROM1-containing proteoliposomes can reveal organizational principles

When designing in vitro experiments for ROM1, researchers should carefully consider the lipid composition, as the specialized environment of photoreceptor discs may be critical for proper protein function and interactions.

What statistical approaches are most appropriate for analyzing developmental defects in ROM1 knockout models?

The analysis of developmental defects in ROM1 knockout models requires statistical approaches that can handle the complexity and variability inherent in biological systems:

Recommended statistical methods:

  • Mixed-effects models:

    • Account for both fixed effects (genotype, age) and random effects (animal-to-animal variation)

    • Appropriately handle nested data structures (multiple measurements per animal)

    • Provide more statistical power than simpler analyses

    • Example application: Analyzing outer segment diameter across multiple animals and retinal locations

  • Survival analysis techniques:

    • Useful for time-to-event data (e.g., photoreceptor degeneration)

    • Handle censored observations appropriately

    • Include Kaplan-Meier curves and Cox proportional hazards models

    • Example application: Comparing rates of photoreceptor loss between genotypes

  • Morphometric analysis pipelines:

    • Automated measurement of structural features from microscopy images

    • Reduce observer bias through standardized protocols

    • Generate large datasets for robust statistical analysis

    • Example application: Quantifying disc enclosure rates from TEM images

  • Ratio of Means (RoM) approach:

    • Alternative to traditional mean difference methods when analyzing continuous outcomes

    • Provides a clinically interpretable effect measure for meta-analysis

    • Exhibits comparable performance characteristics to mean difference methods in terms of bias, coverage, power, and heterogeneity

    • Particularly useful when comparing results across different studies or laboratories

Sample size considerations:

For ROM1 studies, adequate sample sizes are critical due to the variability observed, particularly in knockout models. For analyzing parameters like open disc number, where Rom1-/- mice show high variability (from ~7 to ~30 open discs) , power calculations should account for:

  • The increased variance in experimental groups

  • The need for sufficient biological replicates (different animals)

  • The requirement for technical replicates (multiple measurements per animal)

  • The anticipated effect size based on preliminary data

A properly powered study typically requires at least 3 animals per genotype with a minimum of 60-70 outer segments analyzed per retina to detect differences in parameters like outer segment diameter .

How can CRISPR-Cas9 genome editing be optimized for studying ROM1 function in retinal disease models?

CRISPR-Cas9 technology offers unprecedented opportunities for precise genetic manipulation to study ROM1 function in disease contexts:

Optimization strategies:

  • Guide RNA design considerations:

    • Target conserved functional domains based on structural insights

    • Design multiple gRNAs to achieve high editing efficiency

    • Avoid off-target effects by thorough bioinformatic screening

    • Consider using paired nickases for enhanced specificity

  • Delivery methods for retinal tissues:

    • AAV vectors show high tropism for photoreceptors

    • Subretinal injection provides localized delivery to photoreceptors

    • Electroporation effective for developing retina

    • Lipid nanoparticles offer alternative non-viral delivery

  • Precise editing strategies:

    • Homology-directed repair (HDR) for knock-in models

    • Base editing for introducing specific point mutations

    • Prime editing for precise insertions or deletions without DSBs

    • Conditional approaches using Cre-loxP systems for temporal control

  • Validation approaches:

    • Deep sequencing to quantify editing efficiency

    • Western blotting and immunohistochemistry to confirm protein alterations

    • Functional assays (ERG) to assess physiological impact

    • Ultrastructural analysis by TEM to examine morphological effects

Research applications:

CRISPR editing enables the creation of sophisticated ROM1 models including:

  • Patient-specific mutations: Introducing specific disease-associated variants to study pathogenic mechanisms

  • Domain swaps: Replacing portions of ROM1 with PRPH2 sequences to identify functional domains

  • Reporter knock-ins: Adding fluorescent tags at endogenous loci to track native protein dynamics

  • Conditional knockouts: Temporal control of ROM1 deletion to distinguish developmental from maintenance roles

These approaches provide powerful tools for understanding ROM1's role in photoreceptor biology and disease, beyond what traditional knockout models can reveal.

What are the current hypotheses regarding the evolutionary conservation of ROM1 and its functional divergence from PRPH2?

The evolutionary relationship between ROM1 and PRPH2 presents fascinating insights into photoreceptor specialization across species:

Current evolutionary hypotheses:

  • Gene duplication and specialization:

    • ROM1 and PRPH2 likely arose from an ancestral gene duplication event

    • Following duplication, PRPH2 retained essential functions while ROM1 evolved more specialized roles

    • This pattern is consistent with the asymmetric effects of mutations (PRPH2 mutations cause severe disease, ROM1 mutations have milder effects)

  • Functional redundancy as evolutionary buffer:

    • The partial redundancy between ROM1 and PRPH2 may provide evolutionary resilience

    • ROM1 could serve as a genetic buffer, reducing selective pressure on PRPH2

    • This arrangement allows for evolutionary experimentation while maintaining essential functions

  • Species-specific adaptation:

    • The relative importance of ROM1 vs. PRPH2 may vary across species

    • Differences in outer segment morphology between species could reflect varying reliance on each protein

    • Analysis of ROM1/PRPH2 ratio across species with different visual ecologies could reveal adaptive patterns

Evidence from comparative analysis:

The tryptophan-arginine pair in the L1 loop is conserved in rhomboid proteases across evolution, suggesting fundamental functional importance . This conservation pattern provides clues about critical functional domains that have been maintained through evolutionary history.

The conserved histidine-145 near the end of the loop forms a hydrogen bond with the conserved asparagine-154 on transmembrane helix 2, potentially maintaining proper loop conformation . Such structural features may represent evolutionary constraints that limit divergence in certain protein regions while allowing others to specialize.

Researchers investigating the evolutionary aspects of ROM1 should consider both sequence conservation and structural constraints when formulating hypotheses about functional divergence and specialization.

How can insights from ROM1 research inform therapeutic strategies for retinal degenerative diseases?

ROM1 research has significant implications for developing therapeutic approaches for retinal degenerative diseases:

Therapeutic strategy implications:

  • Gene augmentation approaches:

    • ROM1 supplementation may be beneficial in cases with haploinsufficiency

    • The discovery that increased PRPH2 can compensate for ROM1 deficiency suggests that PRPH2 augmentation could be a therapeutic strategy for ROM1-related diseases

    • Dosage must be carefully controlled as improper tetraspanin ratios may exacerbate pathology

  • Small molecule stabilizers:

    • Compounds that stabilize ROM1-PRPH2 interactions could enhance complex formation

    • Pharmacological chaperones might improve folding and trafficking of mutant proteins

    • High-throughput screening approaches can identify molecules that prevent complex dissociation

  • Proteostasis modulation:

    • Enhancing cellular quality control may reduce accumulation of misfolded ROM1 or PRPH2

    • Autophagy modulators could improve clearance of protein aggregates

    • Endoplasmic reticulum stress reducers might prevent photoreceptor cell death

  • Rational protein engineering:

    • Creating chimeric proteins combining functional domains of ROM1 and PRPH2

    • Engineering enhanced stability variants resistant to mutation-induced misfolding

    • Developing minimal functional fragments that retain essential activities

Clinical implications of ROM1 research:

The finding that ROM1 knockouts display delayed disc enclosure and altered disc morphology helps explain the pathophysiology of related retinal diseases. The compensatory relationship between ROM1 and PRPH2 suggests that disease mechanisms may involve complex protein homeostasis issues rather than simple loss-of-function effects.

Understanding the molecular mechanisms of ROM1 function provides rational targets for intervention, potentially leading to treatments for currently incurable retinal degenerative conditions.

What are the methodological challenges in correlating ROM1 structural variations with clinical phenotypes?

Correlating ROM1 structural variations with clinical phenotypes presents several methodological challenges that researchers must address:

Key methodological challenges:

  • Genotype-phenotype correlation complexity:

    • ROM1 variants may cause disease only in combination with PRPH2 mutations (digenic inheritance)

    • Modifier genes influence phenotypic expression of ROM1 variations

    • Environmental factors may alter disease onset and progression

    • Age-related changes confound longitudinal assessments

  • Clinical assessment standardization:

    • Different clinical centers use varying protocols for retinal imaging

    • Visual function testing methodologies lack standardization

    • Disease progression markers differ between studies

    • Patient-reported outcomes vary in reliability and validity

  • Structural analysis limitations:

    • In vivo imaging cannot resolve disc-level abnormalities

    • Tissue samples are rarely available for ultrastructural analysis

    • Animal models may not fully recapitulate human disease

    • Protein structural predictions have inherent uncertainty

  • Sample size constraints:

    • ROM1-associated diseases are relatively rare

    • Families with identical mutations may be geographically dispersed

    • Longitudinal follow-up is difficult to maintain

    • Statistical power is limited for rare variants

Proposed methodological solutions:

  • Integrated multi-omics approaches:

    • Combine genomic, transcriptomic, and proteomic analyses

    • Include structural modeling based on related proteins

    • Correlate with detailed clinical phenotyping

    • Apply machine learning to identify complex patterns

  • Collaborative research networks:

    • Establish standardized assessment protocols

    • Share data through centralized repositories

    • Pool rare cases to increase statistical power

    • Implement common outcome measures

  • Advanced imaging methodologies:

    • Adaptive optics to visualize individual photoreceptors

    • OCT with cellular resolution to assess outer segment integrity

    • Functional imaging to correlate structure with visual function

    • Longitudinal imaging to track disease progression

  • Patient-derived models:

    • iPSC-derived retinal organoids from patients with ROM1 variants

    • CRISPR-engineered isogenic lines to control for genetic background

    • 3D retinal cultures to model outer segment formation

    • High-content screening platforms for phenotypic analysis

These methodological approaches can help overcome the challenges inherent in correlating ROM1 structural variations with clinical phenotypes, ultimately advancing our understanding of disease mechanisms and therapeutic opportunities.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.