Recombinant Rhyncholestes raphanurus NADH-ubiquinone oxidoreductase chain 4L (MT-ND4L)

What is MT-ND4L and what is its role in cellular metabolism?

MT-ND4L (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 4L) is a protein component of Complex I in the mitochondrial electron transport chain. This protein functions as a critical subunit of NADH dehydrogenase (ubiquinone), which is located in the mitochondrial inner membrane and represents the largest of the five complexes in the electron transport chain . MT-ND4L contributes to the transfer of electrons from NADH to ubiquinone during the first step of oxidative phosphorylation, creating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis . In Rhyncholestes raphanurus (Chilean shrew opossum), this protein maintains the core functionality while exhibiting species-specific sequence variations that may reflect evolutionary adaptations to different metabolic demands .

What is the protein structure of Rhyncholestes raphanurus MT-ND4L and how does it compare to other mammalian species?

The Rhyncholestes raphanurus MT-ND4L is a small hydrophobic protein consisting of 98 amino acids with a sequence of: MTTIYLN LILAFTLALSGVLIYRSHLLSTLLCLEGMMLSLFIMALTI SHFHMFSLSMAPPILLVFSACEAGVGLALLVKTSNAHGNDH VQSLNLLQC . This protein is highly hydrophobic and forms part of the core transmembrane region of Complex I . Comparative analysis with other mammals shows conservation of key functional domains, particularly in the transmembrane regions. The hydrophobic nature of Rhyncholestes raphanurus MT-ND4L parallels that seen in other species, reflecting the protein's role in the lipid-rich inner mitochondrial membrane environment. When compared to the MT-ND4L of Nephelomys albigularis (98 amino acids: MSPIYINLMMAFIFSLLGTLLFRSHLMSTLLCLEGMMLSLFIMVTSSALNTQSMITYVIP ITMLVFGACEAAIGLALLVMISNTYGTDYVQNLNLLQC), we observe similarities in hydrophobicity patterns and transmembrane domains, though with species-specific variations that may reflect different evolutionary pressures .

How is recombinant MT-ND4L typically expressed and purified for research purposes?

For successful expression and purification of recombinant MT-ND4L from Rhyncholestes raphanurus, researchers typically employ bacterial expression systems, particularly E. coli, as demonstrated with similar proteins from other species . Due to the highly hydrophobic nature of MT-ND4L, expression often requires optimization of culture conditions and the use of fusion tags (such as His-tags) to facilitate purification .

The general methodology includes:

• Gene synthesis or cloning of the MT-ND4L sequence into an appropriate expression vector

• Transformation into an E. coli expression strain

• Induction of protein expression under optimized conditions

• Cell lysis and membrane fraction separation

• Solubilization using appropriate detergents

• Affinity chromatography (typically using His-tag)

• Buffer exchange to a storage buffer containing glycerol for stability

The purified protein is typically stored in a Tris-based buffer with 50% glycerol to maintain stability during freeze-thaw cycles . For Rhyncholestes raphanurus MT-ND4L specifically, extended storage should be at -20°C or -80°C, with working aliquots maintained at 4°C for up to one week to minimize protein degradation .

What experimental considerations are important when studying interactions between recombinant MT-ND4L and other Complex I subunits?

When investigating interactions between recombinant Rhyncholestes raphanurus MT-ND4L and other Complex I subunits, several critical factors must be addressed:

• Detergent selection: The choice of detergent is crucial for maintaining the native conformation of this highly hydrophobic protein. Mild detergents like DDM (n-dodecyl β-D-maltoside) or digitonin are often preferred to preserve protein-protein interactions.

• Reconstitution systems: Liposome or nanodisc reconstitution may be necessary to study MT-ND4L in a membrane-like environment that better mimics its native state.

• Co-expression strategies: Co-expressing MT-ND4L with interacting subunits can improve folding and stability, potentially using dual-vector systems in E. coli or eukaryotic expression systems.

• Biophysical methods optimization: Techniques such as cross-linking mass spectrometry, FRET (Förster Resonance Energy Transfer), or BN-PAGE (Blue Native Polyacrylamide Gel Electrophoresis) must be optimized for the specific properties of MT-ND4L.

Since MT-ND4L forms the core of the transmembrane region of Complex I, it has extensive interactions with other mitochondrially encoded subunits . Research should account for the unusual feature of gene overlap between MT-ND4L and MT-ND4, which suggests potential co-regulation and functional interaction between these proteins .

What are the best approaches for studying the role of MT-ND4L mutations in mitochondrial dysfunction?

To effectively study MT-ND4L mutations and their impact on mitochondrial function, researchers should consider:

• CRISPR/Cas9 mitochondrial genome editing: Though challenging due to the unique properties of mtDNA, recent advances allow for precise editing of mitochondrial genes.

• Cybrid cell technology: Creating transmitochondrial cybrid cells containing patient-derived mitochondria with MT-ND4L mutations in a control nuclear background allows isolation of mitochondrial effects.

• Recombinant protein assays: Comparing wild-type and mutant recombinant MT-ND4L proteins in reconstituted systems to directly measure effects on:

  • Electron transfer rates

  • ROS production

  • Proton pumping efficiency

  • Assembly of Complex I

• Animal models: Developing mouse models with specific MT-ND4L mutations to study whole-organism effects.

MT-ND4L mutations, such as the T10663C (Val65Ala) variant, have been implicated in Leber hereditary optic neuropathy (LHON) . Investigating specific mutations in recombinant Rhyncholestes raphanurus MT-ND4L could provide comparative insights into how conserved or divergent the functional impacts of these mutations are across species.

How can researchers accurately assess the functional activity of recombinant MT-ND4L in vitro?

Assessing the functional activity of recombinant Rhyncholestes raphanurus MT-ND4L requires specialized techniques addressing its role in Complex I:

• Reconstitution assays: Incorporating the recombinant protein into proteoliposomes with other Complex I components to measure:

  • NADH:ubiquinone oxidoreductase activity

  • Proton pumping efficiency

  • Membrane potential generation

• Spectroscopic methods:

  • Monitoring NADH oxidation at 340 nm

  • Following ubiquinone reduction

  • Measuring electron transfer through spectroscopic detection of redox centers

• Oxygen consumption measurements:

  • High-resolution respirometry

  • Oxygen electrode systems to assess integrated function

• Functional complementation:

  • Using MT-ND4L-deficient systems to test functional rescue by the recombinant protein

  • Yeast or bacterial complementation systems with engineered deficiencies

When conducting these assays, it is essential to maintain appropriate temperature and pH conditions that reflect the native environment of Rhyncholestes raphanurus, as these parameters can significantly affect the activity of mitochondrial proteins and may differ from conditions optimized for human or common model organisms.

What insights can Rhyncholestes raphanurus MT-ND4L provide for understanding mitochondrial evolution in marsupials?

The study of Rhyncholestes raphanurus MT-ND4L offers valuable insights into marsupial mitochondrial evolution:

• Phylogenetic analysis: Comparing the amino acid sequence of Rhyncholestes raphanurus MT-ND4L (MTTIYLN LILAFTLALSGVLIYRSHLLSTLLCLEGMMLSLFIMALTISHFHMFSLSMAPPILLVFSACEAGVGLALLVKTSNAHGNDHVQSLNLLQC) with other marsupials and placental mammals can reveal clade-specific adaptations in Complex I.

• Selection pressure analysis: Evaluating the ratio of non-synonymous to synonymous substitutions in MT-ND4L across marsupials may identify regions under positive selection, potentially related to metabolic adaptations.

• Structure-function relationships: The highly conserved nature of MT-ND4L across species despite sequence variations suggests functional constraints that can highlight essential residues and domains.

• Metabolic adaptation markers: Differences in MT-ND4L sequences between Rhyncholestes raphanurus and other marsupials may correlate with metabolic adaptations to different environments and diets, providing insights into the co-evolution of mitochondrial genes with ecological niches.

As one of the most hydrophobic components of Complex I, MT-ND4L's evolutionary conservation pattern provides a window into how fundamental energy production mechanisms have been maintained or adapted throughout marsupial evolution .

How does the structure and function of MT-ND4L differ between Rhyncholestes raphanurus and common laboratory animal models?

Comparative analysis between Rhyncholestes raphanurus MT-ND4L and that of common laboratory models reveals important structural and functional differences:

These differences may impact:

• Enzyme kinetics: Species-specific variations in amino acid composition may alter the efficiency of electron transfer or proton pumping.

• Thermal stability: Adaptations to different body temperatures and environmental conditions across species.

• Interaction with nuclear-encoded subunits: Co-evolution of mitochondrial and nuclear genomes leads to species-specific optimization of subunit interactions.

• Sensitivity to inhibitors: Different species' MT-ND4L variants may show variable responses to Complex I inhibitors, which has implications for comparative toxicology studies.

Understanding these differences is crucial when extrapolating findings from recombinant Rhyncholestes raphanurus MT-ND4L studies to human health applications or when using it as a model for broader mitochondrial research.

What are the optimal conditions for storage and handling of recombinant Rhyncholestes raphanurus MT-ND4L to maintain its structural integrity?

To maintain the structural integrity of recombinant Rhyncholestes raphanurus MT-ND4L, researchers should adhere to these optimized conditions:

• Storage buffer composition:

  • Use Tris-based buffer with 50% glycerol for long-term storage

  • Maintain pH at approximately 8.0 to minimize aggregation

  • Consider adding stabilizing agents such as trehalose (6%) which has been effective for similar proteins

• Temperature considerations:

  • Store at -20°C or -80°C for extended periods

  • Keep working aliquots at 4°C for up to one week

  • Avoid repeated freeze-thaw cycles as they significantly reduce protein activity and stability

• Handling recommendations:

  • Briefly centrifuge vials before opening to collect contents at the bottom

  • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% when preparing aliquots

• Quality control measures:

  • Periodically verify protein integrity using SDS-PAGE

  • Monitor activity using functional assays if feasible

  • Check for aggregation using dynamic light scattering

These storage and handling protocols are specifically optimized for the hydrophobic nature of MT-ND4L and help preserve its native conformation for research applications.

What troubleshooting strategies are recommended when expression of recombinant MT-ND4L yields poor results?

When encountering difficulties with recombinant Rhyncholestes raphanurus MT-ND4L expression, consider the following troubleshooting strategies:

• Codon optimization:

  • Optimize codons for the expression host (typically E. coli)

  • Address rare codons that may cause translational pausing and protein misfolding

• Expression system modifications:

  • Test multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3) - the latter two are engineered for membrane proteins)

  • Consider slower growth at lower temperatures (16-20°C) to improve folding

  • Reduce inducer concentration to slow protein production rate

• Fusion partners and solubility enhancers:

  • Test different fusion tags beyond His-tag (MBP, SUMO, Trx)

  • Include solubility-enhancing sequences

  • Use specialized vectors designed for membrane protein expression

• Detergent screening:

  • Systematically test different detergents for solubilization

  • Consider mixed micelle systems with lipids

  • Explore non-detergent alternatives like amphipols or nanodiscs

• Protein stability enhancements:

  • Add stabilizing ligands during expression

  • Co-express with interacting partners

  • Include specific lipids that may promote proper folding

• Expression verification methods:

  • Use Western blotting with anti-His antibodies for detection of low expression levels

  • Consider GFP fusion constructs to visually monitor expression and localization

  • Employ mass spectrometry to confirm successful expression of partial products

Implementing these strategies systematically can help overcome the inherent challenges of expressing this hydrophobic, mitochondrial membrane protein in heterologous systems.

What are the most effective methods for validating the structural integrity of recombinant MT-ND4L after purification?

Validating the structural integrity of purified recombinant Rhyncholestes raphanurus MT-ND4L requires multiple complementary approaches:

• Biochemical analysis:

  • SDS-PAGE to confirm molecular weight (approximately 11 kDa)

  • Size exclusion chromatography to assess oligomeric state and aggregation

  • Circular dichroism (CD) spectroscopy to verify secondary structure elements (predominantly alpha-helical for transmembrane domains)

• Functional validation:

  • Reconstitution into liposomes to test membrane integration

  • Complex I assembly assays with complementary subunits

  • NADH oxidation activity in reconstituted systems

• Structural integrity assessment:

  • Limited proteolysis to probe correctly folded domains

  • Thermal shift assays to determine stability and proper folding

  • Cysteine accessibility tests to evaluate tertiary structure (MT-ND4L contains a conserved cysteine residue)

• Advanced structural techniques:

  • Hydrogen-deuterium exchange mass spectrometry to probe solvent accessibility

  • Negative stain electron microscopy of reconstituted complexes

  • For highest resolution, cryo-electron microscopy of the protein in nanodiscs or detergent micelles

These validation methods provide complementary information about different aspects of protein structure and function, offering a comprehensive assessment of the recombinant protein's integrity and suitability for downstream applications.

How can studies with recombinant Rhyncholestes raphanurus MT-ND4L contribute to understanding mitochondrial disorders in humans?

Research using recombinant Rhyncholestes raphanurus MT-ND4L can provide valuable insights into human mitochondrial disorders through:

• Comparative functional studies:

  • Parallel analysis of wild-type and mutant forms of MT-ND4L from different species

  • Assessment of how conserved mutations affect function across evolutionarily distant mammals

  • Identification of species-specific compensatory mechanisms that may suggest therapeutic strategies

• Structure-function relationships:

  • Detailed mapping of functional domains in a comparative context

  • Identification of critical residues that, when mutated, lead to disease

  • Understanding how specific mutations like T10663C (Val65Ala) in humans disrupt protein function

• Disease modeling applications:

  • Using recombinant MT-ND4L variants to study specific aspects of Leber hereditary optic neuropathy (LHON)

  • Creating chimeric proteins with human mutation sites introduced into the Rhyncholestes raphanurus sequence

  • Developing high-throughput screening systems for therapeutic compounds

• Evolutionary medicine insights:

  • Understanding why certain mutations are pathogenic in humans but potentially tolerated in other species

  • Identifying natural variations that might protect against dysfunction

  • Exploring species-specific energy metabolism adaptations that could inform therapeutic approaches

By studying MT-ND4L across species, researchers can distinguish between conserved functional elements that are likely essential for all mammals and species-specific adaptations, providing context for understanding human disease mutations.

What experimental approaches can be used to study the impact of MT-ND4L mutations on Complex I assembly and function?

To comprehensively study how mutations in MT-ND4L affect Complex I assembly and function, researchers can employ these experimental approaches:

• Site-directed mutagenesis systems:

  • Generate recombinant Rhyncholestes raphanurus MT-ND4L proteins with specific mutations

  • Create parallel mutations in human MT-ND4L for comparative analysis

  • Develop libraries of mutations spanning the entire protein sequence

• Assembly assay methodologies:

  • Blue Native PAGE to visualize Complex I assembly intermediates

  • Pulse-chase labeling to track assembly kinetics

  • Proximity labeling techniques to map spatial relationships during assembly

  • Immunoprecipitation with antibodies against various Complex I subunits

• Functional impact assessment:

  • High-resolution respirometry to measure oxygen consumption

  • Spectrophotometric assays to quantify NADH oxidation rates

  • Membrane potential measurements using potential-sensitive dyes

  • ROS production assays to detect dysfunction-associated oxidative stress

• Structural analysis approaches:

  • Cryo-electron microscopy of assembled or partially assembled complexes

  • Cross-linking mass spectrometry to identify altered subunit interactions

  • Hydrogen-deuterium exchange to detect conformational changes

• Comparative systems biology:

  • Multi-omics analysis integrating proteomics, metabolomics, and transcriptomics

  • Computational modeling of electron transfer and proton pumping

  • Network analysis of compensatory responses to MT-ND4L dysfunction

These methodologies allow for comprehensive characterization of how specific mutations in MT-ND4L impact Complex I at multiple levels, from molecular interactions to whole-complex function and cellular energy metabolism.

What emerging technologies could enhance our ability to study recombinant MT-ND4L structure and function?

Several cutting-edge technologies show promise for advancing research on recombinant Rhyncholestes raphanurus MT-ND4L:

• Advanced structural biology techniques:

  • Micro-electron diffraction (microED) for membrane protein crystallography

  • Single-particle cryo-electron microscopy at sub-2Å resolution

  • Integrative structural biology combining multiple data sources

  • Advanced NMR methodologies for membrane proteins

• Artificial intelligence applications:

  • AlphaFold2 and RoseTTAFold for improved structure prediction

  • Machine learning algorithms for predicting mutation effects

  • Automated design of optimized constructs for expression

• Biomembrane mimetics:

  • Next-generation nanodiscs with tunable properties

  • Cell-derived vesicles preserving native lipid composition

  • 3D-printed artificial membrane systems

• Single-molecule techniques:

  • Single-molecule FRET to study conformational dynamics

  • Patch-clamp fluorometry for simultaneous functional and structural measurements

  • High-speed atomic force microscopy for visualizing protein dynamics

• Genome editing advances:

  • Mitochondrial-targeted base editors for precise mtDNA modification

  • Improved mitochondrial transformation technologies

  • Synthetic biology approaches to engineer minimal Complex I systems

These emerging technologies will enable researchers to address previously intractable questions about MT-ND4L structure, dynamics, and function, potentially revealing new therapeutic targets for mitochondrial diseases and fundamental insights into bioenergetics.

How might comparative studies between MT-ND4L from Rhyncholestes raphanurus and other species inform the development of mitochondrial therapeutics?

Comparative studies of MT-ND4L across species can drive mitochondrial therapeutic development through:

• Natural variation as therapeutic inspiration:

  • Identifying naturally occurring variants that confer resistance to dysfunction

  • Understanding species-specific adaptations that protect against oxidative stress

  • Discovering compensatory mechanisms that maintain function despite potentially damaging mutations

• Evolutionary robust design principles:

  • Mapping conservation patterns to identify critical functional domains

  • Understanding structural elements that have remained unchanged across diverse evolutionary lineages

  • Identifying regions that tolerate variation as potential sites for therapeutic intervention

• Cross-species pharmacological insights:

  • Testing species-specific responses to Complex I inhibitors and activators

  • Identifying compounds that selectively rescue function of mutant MT-ND4L variants

  • Developing screening platforms using recombinant proteins from multiple species

• Precision medicine applications:

  • Developing mutation-specific therapeutic approaches based on comparative functional studies

  • Creating patient-specific models incorporating the genetic background effects observed in different species

  • Testing gene therapy approaches using insights from naturally occurring sequence variations

By understanding how MT-ND4L function is maintained across diverse species like Rhyncholestes raphanurus, researchers can gain insights into the fundamental principles of mitochondrial function and identify novel therapeutic strategies that might not be apparent from studying human proteins alone.