Recombinant Rice tungro spherical virus Genome polyprotein

Shipped with Ice Packs
In Stock

Description

Introduction to Rice Tungro Spherical Virus

Rice tungro spherical virus (RTSV) belongs to the plant picornavirus group with an RNA genome exceeding 12 kb that encodes a large polyprotein . RTSV works synergistically with Rice tungro bacilliform virus (RTBV) to cause rice tungro disease, a significant threat to rice production across South and Southeast Asia. The virus contains a single-stranded RNA genome of approximately 12 kb that encodes a major polyprotein with various functional domains . The genome organization and expression strategy of RTSV are central to understanding its pathogenicity and developing control measures.

Biological Significance

RTSV plays a crucial role in the rice tungro disease complex by assisting the transmission of RTBV through its leafhopper vector. Understanding the molecular biology of RTSV, particularly its genome polyprotein, has become essential for developing effective management strategies against this devastating rice disease. The recombinant production of RTSV genome polyprotein components has accelerated research in this field significantly.

Classification and Genomic Features

RTSV is classified as a plant picornavirus based on genomic organization and expression strategies . The virus has an RNA genome that encodes multiple proteins through a polyprotein processing mechanism similar to other picornaviruses. Genomic analyses across different isolates reveal significant conservation with nucleotide sequence identities of approximately 95% among Indian isolates and 90% with Philippines isolates .

Structure and Organization of RTSV Genome Polyprotein

The RTSV polyprotein is a large precursor protein encoded by the viral genome. In a south Indian isolate, the RNA genome consists of 12,171 nucleotides (excluding the poly(A) tail) and encodes a putative polyprotein comprising 3,470 amino acids . This polyprotein contains multiple functional domains that are processed into individual proteins during viral replication.

Polyprotein Domain Organization

The RTSV polyprotein contains several functional domains arranged in a specific order along the polypeptide chain. Key domains include regions encoding capsid proteins, a serine-like protease, and an RNA-dependent RNA polymerase . The organization of these domains is crucial for proper processing and function during viral infection.

Functional Motifs and Conserved Regions

The polyprotein contains multiple conserved motifs that are characteristic of picornavirus proteins. These include sequences with similarity to viral serine-like proteases and RNA polymerases . These motifs are essential for the virus's ability to replicate within host cells and produce infectious particles.

Table 1: Key Domains of RTSV Genome Polyprotein

DomainApproximate PositionFunctionNotable Features
Capsid ProteinsN-terminal regionVirus particle formationProcessed into CP1, CP2, and CP3
Serine-like ProteaseC-terminal regionPolyprotein processingContains catalytic residues His2680, Glu2717, Cys2811, His2830
RNA PolymeraseAdjacent to proteaseViral genome replicationShows sequence similarity to other viral RdRps

Expression and Processing of RTSV Genome Polyprotein

The RTSV polyprotein undergoes post-translational processing to generate individual functional proteins. This processing is mediated by a virus-encoded protease that recognizes specific cleavage sites within the polyprotein sequence.

Polyprotein Processing Mechanism

Processing of the RTSV polyprotein is accomplished through the action of a 3C-like serine protease encoded within the polyprotein itself . This protease recognizes specific amino acid sequences as cleavage sites and catalyzes the hydrolysis of peptide bonds at these sites. The protease acts both in cis (on the same polyprotein molecule) and in trans (on other polyprotein molecules), facilitating the generation of mature viral proteins .

Cleavage Sites and Products

Several cleavage sites have been identified in the RTSV polyprotein. Two particularly important sites include Gln2526-Asp2527 (located N-terminal to the protease domain) and Gln2852-Ala2853 (located at the C-terminal end of the protease domain) . Mutation studies have demonstrated that altering these sites affects processing efficiency, with mutations at the Gln2526-Asp2527 site diminishing processing and mutations at the Gln2852-Ala2853 site leading to delayed and partial processing .

Recombinant Production of RTSV Genome Polyprotein

The recombinant expression of RTSV genome polyprotein or its fragments has been crucial for studying the structure, function, and processing of this important viral protein.

Expression Systems and Strategies

Recombinant RTSV polyprotein fragments have been successfully expressed in prokaryotic systems, particularly Escherichia coli. One specific example involves the expression of the C-terminal segment (amino acids 2853-3473) of the RTSV genome polyprotein fused to an N-terminal His tag . This recombinant protein provides valuable material for structural and functional studies of the viral polymerase domain.

Purification and Characterization

The recombinant RTSV polyprotein fragments are typically purified using affinity chromatography methods that exploit the presence of fusion tags, such as the His tag . Following purification, these proteins can be characterized through various biochemical and biophysical techniques to determine their properties and functions.

Table 2: Properties of Recombinant RTSV Polyprotein Fragment (aa 2853-3473)

PropertyDescriptionReference
Expression SystemE. coli
Fusion TagN-terminal His tag
Molecular WeightApproximately 70 kDa
Physical FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0
Purity>90% as determined by SDS-PAGE

Functional Domains and Motifs

The RTSV genome polyprotein contains several functional domains that perform specific roles during viral infection and replication.

Capsid Protein Domains

The N-terminal region of the RTSV polyprotein encodes three capsid proteins (CP1, CP2, and CP3) with predicted molecular masses of 22.5, 22.0, and 33 kDa, respectively . These proteins form the viral capsid that protects the genomic RNA. Among these, CP3 has been identified as the major antigenic determinant on the surface of RTSV particles, making it particularly important for virus-host interactions and serological detection methods .

Protease Domain

The RTSV polyprotein contains a serine-like protease domain that plays a crucial role in polyprotein processing. This 3C-like protease has been extensively studied, and key residues essential for its catalytic activity have been identified, including His2680, Glu2717, Cys2811, and His2830 . Interestingly, the substitution of Asp2735 does not affect proteolytic activity, suggesting it is not directly involved in catalysis .

RNA-Dependent RNA Polymerase Domain

The C-terminal region of the RTSV polyprotein contains an RNA-dependent RNA polymerase (RdRp) domain essential for viral genome replication. This domain shows sequence similarity to other viral RdRps and has been detected as a protein of approximately 70 kDa in infected plant extracts, albeit in very low amounts .

Proteolytic Processing and Enzyme Activity

The proteolytic processing of RTSV polyprotein has been studied using various in vitro systems, providing insights into the mechanisms and regulation of this critical process.

Catalytic Mechanism

The RTSV 3C-like protease demonstrates rapid cleavage of its polyprotein precursors in vitro . Studies using in vitro transcription/translation systems and E. coli expression systems have confirmed the proteolytic activity of the C-terminal region of the polyprotein . The protease acts through a mechanism similar to other viral 3C proteases, recognizing specific amino acid sequences at cleavage sites.

Substrate Specificity

The RTSV protease shows specificity in its substrate recognition. While it effectively processes precursors containing regions of the 3' half of the polyprotein, it does not process substrates consisting of precursors of the coat proteins . This specificity is likely determined by the amino acid sequences surrounding the cleavage sites and the three-dimensional structure of the substrates.

Table 3: Critical Residues in RTSV Protease Catalytic Activity

Amino AcidPositionEffect of MutationRole
His2680Essential for catalytic activityPotential part of catalytic center
Glu2717Essential for catalytic activityPotential part of catalytic center
Asp2735No effect on proteolysisNot involved in catalysis
Cys2811Essential for catalytic activityPotential part of catalytic center
His2830Essential for catalytic activityPotential part of catalytic center

Genetic Diversity and Evolution

Studies on different isolates of RTSV have revealed significant information about the genetic diversity and evolution of this virus, particularly regarding its genome polyprotein.

Phylogenetic Relationships

Phylogenetic analyses based on complete genome sequences have shown that Indian isolates of RTSV cluster together, while isolates from the Philippines (Vt6 and PhilA) form separate clusters . These relationships reflect the geographical distribution and evolutionary history of the virus.

Recombination Events

Recombination analysis has identified multiple recombination events in the RTSV RNA genome. A study using the Recombination Detection Program version 3 detected twelve recombination events in a south Indian isolate . The 5' end and central region of the genome appear to play significant roles in virus evolution through recombination. Isolates from Andhra Pradesh and Odisha in India have been identified as important in the diversification of RTSV in India through recombination events .

Research Applications and Future Perspectives

Recombinant RTSV genome polyprotein and its fragments have numerous applications in research and potential biotechnological applications.

Diagnostic Development

The recombinant expression of RTSV capsid proteins, particularly CP3, has facilitated the development of serological detection methods for RTSV . Antisera raised against these recombinant proteins can be used in various immunoassays for virus detection, including ELISA, Western blotting, and immunogold electron microscopy.

Structure-Function Studies

Recombinant RTSV polyprotein fragments provide valuable materials for detailed structural and functional studies of the viral proteins. These studies can elucidate the mechanisms of polyprotein processing, the structure of the protease and polymerase domains, and the interactions between viral proteins and host factors.

Antiviral Development

Understanding the structure and function of RTSV polyprotein, particularly the protease and polymerase domains, opens avenues for developing targeted antiviral strategies. Inhibitors of these viral enzymes could potentially be developed as control measures against rice tungro disease.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributor.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal results, briefly centrifuge the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which you can use as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag type, please inform us, and we will prioritize developing it accordingly.
Synonyms
Genome polyprotein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2853-3473
Protein Length
Full Length of Mature Protein
Species
Rice tungro spherical virus (strain A) (RTSV) (Rice tungro spherical waikavirus)
Target Protein Sequence
AIETLKETGLLKHIPKGAIGAGEEKLPEHSKKQSLSLEGKGNLGIVGQLTAQLVPTSVTK TTICKSMIHGLIGEIKTEPSVLSAWDRRLPFPPGEWDPMKDAVKKYGSYILPFPTEEIQE VENFLIKKFRRKENSRRTRNVNSLEVGINGIDGSDFWSPIEMKTSPGYPYILKRPSGAQG KKYLFEELEPYPSGRPKYAMKDPELIENYERIKEEVTSGVKPSIMTMECLKDERRKLAKI YEKPATRTFTILSPEVNILFRQYFGDFAAMVMSTRREHFSQVGINPESMEWSDLINSLLR VNTKGFAGDYSKFDGIGSPAIYHSIVNVVNAWYNDGEVNARARHSLISSIVHRDGICGDL ILRYSQGMPSGFAMTVIFNSFVNYYFMALAWMSTVGSSLLSPQGSCKDFDTYCKIVAYGD DNVVSVHEEFLDVYNLQTVAAYLSHFGVTYTDGDKNPIHMSKPYEDITKMSFLKRGFERV ESSGFLWKAPLDKTSIEERLNWIRDCPTPVEALEQNIESALHEAAIHGRDYFDDLVRRLN SALTRVMLPPTDISFEECQARWWASVTGALRAADYTSLVRRASSGHVEFNKKYRDMFRQQ DLPLKEILMKSKPVALLDLEV
Uniprot No.

Target Background

Function
Picornain 3C-like protease is a thiol protease that likely cleaves the polyprotein.
Database Links

KEGG: vg:1497257

Subcellular Location
[Capsid protein 1]: Virion.; [Capsid protein 2]: Virion.; [Capsid protein 3]: Virion.; [Putative helicase]: Host membrane; Multi-pass membrane protein.

Q&A

What is the genomic organization of Rice tungro spherical virus (RTSV)?

RTSV possesses a single-stranded RNA genome approximately 12 kb in length that encodes a large polyprotein and possibly one or two smaller proteins . The complete genome sequence of an Indian isolate revealed 12,171 nucleotides excluding the poly(A) tail, encoding a putative polyprotein of 3,470 amino acids . RTSV is classified as a plant picornavirus based on its genomic features and protein expression strategy . The virus genome contains sequence motifs characteristic of picornaviruses, with the polyprotein harboring domains for structural and non-structural proteins arranged in a specific order .

Research methodology: Complete genome sequencing typically involves RT-PCR amplification of overlapping fragments, cloning into suitable vectors, and Sanger sequencing or next-generation sequencing approaches. For RTSV, specialized primers targeting conserved regions facilitate comprehensive genome assembly.

How is the RTSV polyprotein processed into functional proteins?

The RTSV genome is expressed as a large polyprotein precursor that undergoes proteolytic processing by at least one virus-encoded protease . This 3C-like protease is located adjacent to the C-terminal putative RNA polymerase and shows sequence similarity to viral serine-like proteases . The protease functions both in cis (acting on itself) and in trans (acting on other protein regions), particularly on precursors containing regions of the 3' half of the polyprotein .

Key amino acid residues essential for catalytic activity include His(2680), Glu(2717), Cys(2811), and His(2830), which likely constitute the catalytic center and/or substrate-binding pocket of the RTSV 3C-like protease . Interestingly, mutation studies have shown that Asp(2735) is not essential for proteolytic activity .

Research methodology: Proteolytic processing is typically studied using in vitro transcription/translation systems with site-directed mutagenesis to identify catalytic residues. Western blotting with specific antibodies against predicted cleavage products confirms processing events.

What are the characteristics of RTSV coat proteins?

RTSV capsid comprises three coat protein (CP) species designated as CP1, CP2, and CP3, with predicted molecular masses of 22.5, 22.0, and 33 kDa, respectively . These proteins are cleaved from the viral polyprotein during post-translational processing . Among these, CP3 appears to be the major antigenic determinant on the surface of RTSV particles, as demonstrated by ELISA, Western blotting, and immunogold electron microscopy using antisera against whole virus particles and individual CPs .

In some cases, particularly in crude extracts, CP3 antiserum detected additional proteins (40-42 kDa), which may represent products of CP3 post-translational modification . Interestingly, the CP3-related proteins (42-44 kDa) of Indian RTSV isolates show slightly higher electrophoretic mobility compared to Southeast Asian isolates and demonstrate different responses to cellulolytic enzyme preparations, providing a basis for geographical differentiation .

Research methodology: Coat protein characterization involves expression of individual proteins in E. coli as fusion proteins (e.g., with maltose-binding protein), followed by purification and antibody production. These antibodies are then used in immunological assays to study the native proteins in virus preparations.

What methodological approaches are effective for expressing recombinant RTSV coat proteins?

Recombinant expression of RTSV coat proteins has been successfully achieved in Escherichia coli expression systems . The genes encoding RTSV coat proteins (CP1, CP2, and CP3) can be amplified by PCR, cloned into appropriate expression vectors, and expressed as fusion proteins to enhance solubility and facilitate purification .

A particularly effective approach involves fusion with maltose-binding protein (MBP), which improves protein solubility and provides a convenient purification tag . The expressed fusion proteins can be purified using affinity chromatography and subsequently used for raising polyclonal antisera . Alternative expression systems such as insect cells may be considered for proteins that require eukaryotic post-translational modifications.

Research methodology: For optimal expression, codon optimization for E. coli is recommended, along with careful selection of expression conditions (temperature, induction time, and inducer concentration). Protein solubility can be enhanced by using lower induction temperatures (16-25°C) and specialized E. coli strains designed for expression of heterologous proteins.

How can genetic recombination events in RTSV be detected and analyzed?

Genetic recombination plays a significant role in RTSV evolution and diversification. Advanced bioinformatic tools such as the Recombination Detection Program (RDP) version 3 can identify potential recombination events in RTSV genomic sequences . Analysis of a South Indian isolate revealed twelve recombination events in the RNA genome, suggesting that the 5' end and central region of the genome are particularly important in virus evolution .

Recombination analysis of different geographical isolates indicates that Andhra Pradesh (AP) and Odisha isolates appear to be significant RTSV variants involved in diversification of this virus in India through recombination phenomena . Phylogenetic analysis based on complete genome sequences shows that Indian isolates cluster together, while Philippines isolates form separate clusters .

Research methodology: Recombination analysis requires:

  • Multiple sequence alignment of complete RTSV genomes from different geographical locations

  • Application of recombination detection algorithms with statistical validation

  • Identification of breakpoints and potential parental sequences

  • Phylogenetic analysis of recombinant and non-recombinant regions to confirm relationships

What strategies can be employed to map functional domains in the RTSV protease?

The RTSV 3C-like protease contains several critical amino acid residues necessary for its catalytic function. Site-directed mutagenesis studies have identified His(2680), Glu(2717), Cys(2811), and His(2830) as essential residues, while Asp(2735) is not required for proteolytic activity .

For comprehensive domain mapping, researchers can employ:

  • Sequence alignment with other viral proteases to identify conserved motifs

  • Systematic alanine scanning mutagenesis of suspected catalytic and substrate-binding residues

  • Deletion analysis to define minimal functional domains

  • Structural prediction and modeling using homology with known protease structures

  • In vitro activity assays using synthetic peptides representing putative cleavage sites

The protease demonstrates differential substrate specificity, processing precursors from the 3' half of the polyprotein but not substrates consisting of coat protein precursors . This selective activity provides insights into the hierarchical and regulated processing of the viral polyprotein.

Research methodology: Activity assays typically involve incubating the recombinant protease with substrate peptides or protein precursors under various conditions, followed by SDS-PAGE and Western blot analysis to detect cleavage products. Mass spectrometry can precisely identify cleavage sites.

How can recombinant RTSV proteins be utilized for diagnostic applications?

Recombinant RTSV coat proteins offer significant advantages for developing diagnostic tools for rice tungro disease. Traditional serological assays rely on purified virions as antigens for antibody production, which is challenging due to difficulties in preparing sufficient quantities of purified virus .

Recombinant expression of RTSV coat proteins (CP1, CP2, and CP3) in E. coli provides an alternative source of antigens for antibody production . Studies have shown that recombinant fusion proteins of CP1 and CP3 of RTSV are reactive against anti-tungro rabbit serum, indicating their potential as alternative antigens for producing diagnostic antibodies .

Research methodology:

  • Clone coat protein genes into suitable expression vectors

  • Express proteins as fusions (e.g., with hexahistidine or MBP tags)

  • Purify using affinity chromatography

  • Validate antigenicity using existing antisera

  • Immunize animals to produce new antibodies

  • Evaluate antibody specificity and sensitivity in field samples

  • Develop ELISA, lateral flow, or other immunoassay formats

This approach provides a continuous and standardized source of antigens for antibody production, overcoming limitations of virus purification from infected plants.

What are the molecular determinants of RTSV genetic diversity across geographic regions?

Comparative genomic analysis of RTSV isolates from different geographical regions reveals significant insights into viral evolution and diversity. Complete genome sequence analysis shows that Indian isolates exhibit approximately 95% nucleotide sequence identity to east Indian isolates and 90% to Philippines isolates .

The CP3-related proteins of Indian RTSV isolates demonstrate slightly different electrophoretic properties compared to Southeast Asian isolates, with higher mobility (42-44 kDa vs 40-42 kDa) and different responses to cellulolytic enzyme preparations . Despite these variations, serological studies using antisera against individual CPs found no significant antigenic differences between isolates from the Philippines, Thailand, Malaysia, and India .

Research methodology for molecular diversity studies:

  • Collection of virus isolates from different geographic regions

  • Whole genome sequencing using next-generation sequencing platforms

  • Multiple sequence alignment and identification of conserved and variable regions

  • Calculation of nucleotide and amino acid sequence identities

  • Phylogenetic analysis using appropriate evolutionary models

  • Analysis of selection pressure on different genomic regions

  • Functional characterization of variant proteins

What are the critical factors in designing experiments to express functional RTSV polyprotein domains?

Successful expression of RTSV polyprotein domains requires careful experimental design addressing several key factors:

  • Expression System Selection: E. coli systems are suitable for basic structural proteins like coat proteins , while eukaryotic systems (insect cells, yeast) may be necessary for proteins requiring post-translational modifications or those with complex folding requirements.

  • Construct Design:

    • Include natural viral protease cleavage sites if expressing multiple domains

    • Consider codon optimization for the expression host

    • Add purification tags that minimally interfere with protein folding

    • Design constructs with and without potential signal sequences

  • Expression Conditions:

    • Test multiple induction temperatures (16°C, 25°C, 37°C)

    • Vary inducer concentrations to balance expression level and solubility

    • Consider extended expression times at lower temperatures

  • Protein Purification:

    • Use affinity tags appropriate for the target protein (His, MBP, GST)

    • Include protease cleavage sites for tag removal if necessary

    • Consider buffer composition to maintain protein stability

    • Employ size exclusion chromatography for final purification steps

  • Functional Validation:

    • Develop activity assays specific to the protein domain

    • For proteases, design peptide substrates based on natural cleavage sites

    • For structural proteins, assess assembly competence through electron microscopy

Research methodology: A systematic approach testing multiple constructs and conditions simultaneously is recommended. Small-scale expression trials followed by solubility analysis can inform the selection of optimal conditions before scaling up for purification.

How can researchers effectively study interactions between RTSV polyprotein domains?

Investigating protein-protein interactions among RTSV polyprotein domains is crucial for understanding virus assembly and function. Several complementary approaches can be employed:

  • Yeast Two-Hybrid (Y2H) System: This approach has been successfully used to identify interactions between viral proteins, as demonstrated for the related Rice tungro bacilliform virus (RTBV), where the gene II product (P2) was shown to interact with the coat protein domain .

  • In Vitro Binding Assays: Purified recombinant proteins can be used in pull-down assays, co-immunoprecipitation, or surface plasmon resonance to quantify binding affinities and kinetics.

  • Bimolecular Fluorescence Complementation (BiFC): This technique allows visualization of protein interactions in plant cells, which is particularly relevant for understanding viral protein functions in the native host environment.

  • Mass Spectrometry-Based Approaches: Cross-linking mass spectrometry can identify interaction interfaces between proteins, while hydrogen-deuterium exchange mass spectrometry reveals conformational changes upon binding.

  • Cryo-Electron Microscopy: For viral capsid proteins, cryo-EM can reveal the structural arrangement and interactions in assembled particles.

Research methodology: A multi-technique approach is recommended, starting with screening methods like Y2H followed by validation using biochemical and biophysical techniques. Mutations in key residues can confirm the specificity of interactions and map binding interfaces.

What methodological approaches are effective for studying RTSV protease substrate specificity?

Understanding RTSV protease substrate specificity is essential for elucidating polyprotein processing and developing potential antiviral strategies. Several approaches can be employed:

  • Peptide Library Screening: Synthetic peptide libraries based on predicted cleavage sites can be tested for protease activity using fluorescence resonance energy transfer (FRET) or high-performance liquid chromatography (HPLC).

  • Mutational Analysis of Cleavage Sites: Systematic mutation of amino acids at positions surrounding known cleavage sites can reveal the sequence requirements for efficient processing.

  • Structural Biology Approaches: X-ray crystallography or NMR spectroscopy of the protease in complex with substrate analogs can provide atomic-level insights into substrate recognition.

  • Computational Prediction: Machine learning algorithms trained on known viral protease cleavage sites can predict potential sites in the RTSV polyprotein.

  • In Vitro Translation Systems: Cell-free translation systems expressing partial polyprotein constructs can be used to study processing events in a controlled environment.

Research methodology: The RTSV protease has been shown to act both in cis and in trans on precursors containing regions of the 3' half of the polyprotein but does not process coat protein precursors . This selective activity provides a foundation for designing experiments to further characterize substrate specificity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.