Recombinant Ricinus communis CASP-like protein RCOM_0464280 (RCOM_0464280)

Shipped with Ice Packs
In Stock

Description

Production and Quality Control

Expression System:

  • Host: Escherichia coli (prokaryotic expression)

  • Yield: Available in 50 µg quantities (scalable production)

Purification Metrics:

Quality AttributeSpecification
Purity>90% (SDS-PAGE verified)
EndotoxinsNot quantified in available data
Activity TestingNo functional assays reported

Research Applications and Limitations

Potential Uses:

  1. Study of Casparian strip formation mechanisms

  2. Protein-protein interaction assays (though no confirmed interactors reported)

  3. Antibody production against plant barrier proteins

Current Knowledge Gaps:

  • No peer-reviewed studies specifically analyzing RCOM_0464280 function

  • Pathway involvement remains uncharacterized

  • Orthologs in Arabidopsis (AtCASP) and rice (OsCASP) show roles in ion transport , but RcCASPL4C1 functionality remains unverified

Comparative Analysis With CASP Family

Data from Arabidopsis/rice homologs suggests potential characteristics:

FeatureAtCASPOsCASPRcCASPL4C1
Avg. Length152-297 residues 153-421 residues 192 residues
Chromosomal DistributionClustered Dispersed Unknown
Demonstrated RoleIon transport Stress response Undetermined

Critical Research Considerations

  1. Sequence Variability: The "partial" designation in some products vs full-length claims requires verification

  2. Post-Translational Modifications: Unlikely in E. coli-expressed protein, limiting physiological relevance

  3. Commercial Limitations:

    • No batch-specific activity data

    • Inconsistent pricing between vendors

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please include them in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery details.
Note: All of our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
RCOM_0464280; CASP-like protein 4C1; RcCASPL4C1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-192
Protein Length
full length protein
Species
Ricinus communis (Castor bean)
Target Names
RCOM_0464280
Target Protein Sequence
MRSPQSLRNGETPSPSPRPPRFPTPHFHSTVSLQKLKRFNLLILVFRLSTFCFSLASSVF MLTNPTWYHFDAFRYVFAANAIVAIYSLFEMAASVWEISRGNTLFPEILQVWFDFGHDQV FAYLLLSADSAATALAKTLKGGDTCAASNAFCVQSYIAIALGFAGFLFLGLSSLLSGFRV VCFLINGSRFYV
Uniprot No.

Target Background

Database Links

KEGG: rcu:8265958

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is RCOM_0464280 and what is its structural classification?

RCOM_0464280 is a CASP-like protein identified in the Ricinus communis (castor) genome. It belongs to the broader family of Casparian strip membrane proteins (CASPs), which are essential components involved in generating specialized plasma membrane domains and directing local cell wall modifications in plants . As a CASP-like protein, RCOM_0464280 shares structural similarities with other members of this family, particularly in its transmembrane domains and conserved residues in the second extracellular loop (EL2) .

Structurally, CASP-like proteins typically contain:

  • Multiple transmembrane domains with conserved residues

  • Extracellular loops (particularly EL1 and EL2) with varying degrees of conservation

  • Specific amino acid signatures that determine their localization and function

The full-length RCOM_0464280 protein consists of 192 amino acids, as indicated in the recombinant protein information .

How does RCOM_0464280 relate to other CASP-like proteins evolutionarily?

Evolutionary analysis positions RCOM_0464280 within the broader CASP-like (CASPL) protein family found across plant species. Phylogenetic studies have revealed conservation between CASPLs and the MARVEL protein family, with the most highly conserved residues located in the transmembrane domains .

CASP-like proteins in plants have been particularly studied for their role in forming membrane domains and contributing to cell wall modifications. In the case of Ricinus communis, which is a spermatophyte, we would expect RCOM_0464280 to potentially contain the nine-amino acid signature (ESLPFFTQF) in the first extracellular loop that is highly conserved among spermatophytes . This signature is absent in non-vascular plants like Physcomitrella patens and Selaginella moellendorffii .

Researchers interested in evolutionary relationships should consider:

  • Comparing conserved domains across multiple plant species

  • Examining the presence/absence of the nine-amino acid signature in the EL1 loop

  • Analyzing conservation patterns in transmembrane domains

What expression systems are recommended for producing recombinant RCOM_0464280?

Based on available information, E. coli has been successfully used as an expression system for producing recombinant RCOM_0464280 protein with a His-tag . This suggests that bacterial expression systems are suitable for this protein.

For researchers planning to express RCOM_0464280, consider the following methodology:

  • Clone the full-length coding sequence (1-192 amino acids) into an appropriate expression vector

  • Transform E. coli with the recombinant vector

  • Induce protein expression under optimized conditions

  • Purify using affinity chromatography, taking advantage of the His-tag

It's worth noting that both full-length and partial recombinant versions of the protein have been produced , offering flexibility depending on your research requirements.

What experimental approaches can best determine RCOM_0464280 localization in plant cell membranes?

To investigate the subcellular localization of RCOM_0464280, researchers should consider approaches similar to those used for other CASP family proteins:

  • Fluorescent Protein Fusion Method:

    • Generate constructs with RCOM_0464280 fused to fluorescent reporters (GFP, mCherry)

    • Express under either native or constitutive promoters

    • Visualize using confocal microscopy to track localization patterns

  • Domain Mutation Analysis:
    This approach has proven valuable for understanding CASP localization mechanisms. Based on studies with AtCASP1:

    • Generate point mutations in conserved residues, particularly in TM3 and EL2

    • Compare localization patterns with wild-type protein

    • Key residues to consider include the conserved Asp in TM3 and residues in EL2 like C168, F174, C175, G158, and W164

  • Heterologous Expression Studies:

    • Express RCOM_0464280 in model systems like Arabidopsis

    • Use the native promoter (approximately 2kb upstream of start codon)

    • Compare localization with endogenous CASP proteins

Evidence from other CASP proteins suggests that conserved residues in transmembrane domains are crucial for protein localization. For instance, mutation of the conserved Asp residue in TM3 of AtCASP1 (D134H) resulted in no detectable fluorescence, suggesting this residue is essential for correct protein folding .

How can CRISPR-Cas9 technology be optimized for modifying RCOM_0464280 in Ricinus communis?

CRISPR-Cas9 genome editing in Ricinus communis is still in developing stages, with a key limitation being the identification of appropriate endogenous promoters for guide RNA expression . For researchers looking to modify RCOM_0464280 using CRISPR-Cas9, the following methodological approach is recommended:

  • U6 Promoter Selection:

    • Utilize the identified endogenous U6 promoters from Ricinus communis

    • Optimal promoter length is approximately 300 bp from the transcription start site

    • Consider the six U6 snRNA genes identified in the castor genome as potential promoter sources

  • sgRNA Design:

    • Design specific guide RNAs targeting RCOM_0464280 coding sequences

    • Focus on regions with minimal off-target effects in the castor genome

    • Consider targeting conserved functional domains identified through homology studies

  • Delivery Method:

    • Use particle delivery methods, which have been successfully tested for castor cells

    • Alternative methods include Agrobacterium-mediated transformation or protoplast transformation

  • Functional Verification:

    • Design assays to verify changes in RCOM_0464280 expression or function

    • Consider assessing cell wall integrity and membrane domain formation

This approach leverages the recent advances in castor genome editing while addressing the specific challenges of working with this species.

What is the functional significance of conserved residues in RCOM_0464280 and how can they be experimentally tested?

Based on studies of other CASP family proteins, certain conserved residues in RCOM_0464280 are likely crucial for its function. The functional significance of these residues can be experimentally tested through the following approaches:

  • Site-Directed Mutagenesis:

    • Target conserved residues in transmembrane domains, particularly in TM3

    • The conserved Asp residue (equivalent to D134 in AtCASP1) should be prioritized as it appears essential for proper protein folding

    • Create mutations in the conserved residues of EL2 that are shared among CASP-like proteins

  • Functional Complementation Assays:

    • Express mutated versions of RCOM_0464280 in knockout/knockdown lines

    • Assess the ability of mutated proteins to restore wild-type phenotypes

    • Measure specific parameters related to cell wall integrity and membrane domain formation

  • Protein-Protein Interaction Studies:

    • Use techniques such as yeast two-hybrid, co-immunoprecipitation, or pull-down assays to identify interacting partners

    • Compare interaction profiles between wild-type and mutated versions of RCOM_0464280

Table: Critical Residues Based on CASP Family Studies

DomainResidue Position (AtCASP1)MutationEffect on LocalizationPotential Equivalent in RCOM_0464280
TM3D134D134HNo visible fluorescence (lethal)To be determined by alignment
EL2G158G158SDelayed localization, low signalTo be determined by alignment
EL2W164W164GExcluded from CSD, almost undetectableTo be determined by alignment
EL2C168C168SPersistent lateral membrane localizationTo be determined by alignment
EL2F174F174VPersistent lateral membrane localizationTo be determined by alignment
EL2C175C175SPersistent lateral membrane localizationTo be determined by alignment

Note: The exact correspondence between AtCASP1 residues and RCOM_0464280 would need to be determined through sequence alignment .

What experimental design would best elucidate the role of RCOM_0464280 in membrane domain formation?

A comprehensive experimental design to investigate RCOM_0464280's role in membrane domain formation would include:

  • Loss-of-Function Analysis:

    • Generate CRISPR/Cas9 knockout or RNAi knockdown lines for RCOM_0464280

    • Assess membrane domain integrity using fluorescent markers

    • Examine cell wall modifications in the mutant lines

    • Analyze plant phenotype, particularly in roots where Casparian strips are crucial

  • Gain-of-Function Analysis:

    • Overexpress RCOM_0464280 under constitutive or inducible promoters

    • Assess impact on membrane domain formation and cell wall structure

    • Investigate potential ectopic formation of membrane domains

  • Domain Swapping Experiments:

    • Create chimeric proteins by swapping domains between RCOM_0464280 and other CASP family members

    • Focus on the nine-amino acid signature in EL1 that is conserved in spermatophytes

    • Express these chimeric proteins in appropriate background lines

    • Assess localization and functionality

  • Live-Cell Imaging:

    • Use advanced microscopy techniques (FRAP, FRET, PALM) to study real-time dynamics

    • Track RCOM_0464280 movement and assembly into membrane domains

    • Analyze the temporal sequence of domain formation

This multi-faceted approach would provide comprehensive insights into RCOM_0464280's role in membrane domain formation and associated cell wall modifications.

How can heterologous expression systems be used to study RCOM_0464280 function across species?

Heterologous expression systems offer valuable insights into protein function across species. For RCOM_0464280, the following methodological approach is recommended:

This methodological approach leverages the evolutionary conservation of CASP proteins to understand the specific functions of RCOM_0464280 in Ricinus communis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.