Recombinant Ricinus communis CASP-like protein RCOM_0679870 (RCOM_0679870)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
RCOM_0679870; CASP-like protein 1D1; RcCASPL1D1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Ricinus communis (Castor bean)
Target Names
RCOM_0679870
Target Protein Sequence
MASTDKPDPEAIKSEVPQPPPPAPLRRDYFAVDVGLRVFLFATTLTAIVVMSTAKQTELA PVPGVPGLRVPVEAKFNHSPAFIYFVAALSVACLYSIITTLASLGVIAKPIYATKFLFYY ALWDVLMLGIVAAATGAAGGVAYIGLKGNSHTRWTKICNVYDTFCKHVGSALAISLAASV VLVLLIMLSVCSLYSRVRRAE
Uniprot No.

Target Background

Database Links

KEGG: rcu:8262392

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How should RCOM_0679870 be stored and reconstituted for experimental use?

For optimal stability and activity, RCOM_0679870 should be stored as follows:

Storage ConditionRecommendation
Long-term storage-20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles
Working aliquots4°C for up to one week
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0

For reconstitution:

  • Briefly centrifuge the vial before opening

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended: 50%)

  • Aliquot for long-term storage

Repeated freeze-thaw cycles should be avoided as they may compromise protein integrity and activity.

What expression systems are suitable for RCOM_0679870 production?

The commercially available RCOM_0679870 is expressed in E. coli with an N-terminal His tag . When choosing an expression system for research purposes, consider:

  • E. coli system: Suitable for basic structural studies but may not provide all post-translational modifications

  • Insect cell system: May better preserve protein folding and some post-translational modifications

  • Mammalian expression system: Provides the most authentic post-translational modifications

For transmembrane proteins like RCOM_0679870, expression can be particularly challenging. Consider:

  • Using specialized E. coli strains designed for membrane proteins

  • Optimizing codon usage for the expression host

  • Employing fusion tags that enhance solubility

  • Testing different detergents for extraction and purification

What is known about the biological function of RCOM_0679870?

While specific research on RCOM_0679870's function is limited in the available literature, analysis of its sequence characteristics suggests it belongs to the CASP (CCAAT-displacement protein alternatively spliced product) family. Based on general knowledge of CASP-like proteins:

  • These proteins often function in membrane transport or signaling

  • The transmembrane domains suggest potential roles in:

    • Cell membrane integrity

    • Transport of specific molecules

    • Signal transduction

    • Cell-cell communication

To elucidate its specific function, researchers should consider:

  • Co-immunoprecipitation studies to identify interaction partners

  • Subcellular localization experiments using fluorescent tags

  • Knockout/knockdown studies in appropriate plant models

  • Comparative analysis with other CASP family proteins

How can I design experiments to study protein-protein interactions involving RCOM_0679870?

For studying protein-protein interactions of RCOM_0679870, consider the following methodological approaches:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-His antibodies to pull down His-tagged RCOM_0679870

    • Identify binding partners via mass spectrometry

    • Validate interactions with western blotting

  • Yeast Two-Hybrid (Y2H):

    • Create a bait construct with RCOM_0679870

    • Screen against a Ricinus communis cDNA library

    • Note: As RCOM_0679870 is likely a membrane protein, consider using a modified membrane Y2H system

  • Bimolecular Fluorescence Complementation (BiFC):

    • Fuse RCOM_0679870 with one half of a fluorescent protein

    • Fuse potential interacting partners with the complementary half

    • Observe reconstituted fluorescence in planta

  • Proximity-based labeling:

    • Create a fusion of RCOM_0679870 with BioID or APEX2

    • Express in plant cells and add biotin

    • Identify biotinylated proteins via mass spectrometry

These approaches can be used complementarily to strengthen evidence for genuine interactions.

What structural domains in RCOM_0679870 are critical for its function and how can they be analyzed?

Based on sequence analysis, RCOM_0679870 likely contains several structural domains including transmembrane regions. To analyze these domains:

  • Computational analysis:

    • Use tools like TMHMM, Phobius, or HMMTOP to predict transmembrane regions

    • Apply SMART or Pfam to identify conserved domains

    • Employ homology modeling if structural homologs exist

  • Experimental validation:

    • Create domain deletion mutants to assess functional consequences

    • Employ site-directed mutagenesis for targeted amino acid substitutions

    • Use circular dichroism (CD) spectroscopy to analyze secondary structure

  • Advanced structural studies:

    • X-ray crystallography (challenging for membrane proteins)

    • Cryo-electron microscopy for larger complexes

    • NMR spectroscopy for flexible regions or smaller domains

A predicted domain organization table based on sequence analysis might look like:

DomainResidue RangePredicted Function
N-terminal domain1-40Potentially cytoplasmic, regulation
Transmembrane domain 141-63Membrane anchoring
Extracellular/luminal loop64-110Potential ligand binding
Transmembrane domain 2111-133Membrane spanning
C-terminal domain134-201Potentially cytoplasmic, protein-protein interactions

Note: This domain prediction is speculative and requires experimental validation.

How can I assess the functional activity of purified RCOM_0679870?

Without specific knowledge of RCOM_0679870's function, several approaches can be used to assess potential activities:

  • Lipid binding assays:

    • Protein-lipid overlay assays using PIP strips

    • Liposome binding assays with fluorescently labeled lipids

    • Surface plasmon resonance (SPR) with immobilized lipids

  • Transport assays (if it functions as a transporter):

    • Reconstitution into liposomes with fluorescent substrate analogs

    • Measurement of substrate flux in proteoliposomes

    • Patch-clamp analysis if ion transport is suspected

  • Signaling assays:

    • Phosphorylation state analysis

    • Measurement of downstream signaling molecules

    • Reporter gene assays in heterologous expression systems

  • Binding partner analysis:

    • Pull-down assays with potential ligands

    • Isothermal titration calorimetry (ITC) for binding kinetics

    • Microscale thermophoresis for interaction studies

Remember to include appropriate controls in all functional assays, such as heat-inactivated protein or known functional homologs.

What are the best approaches for studying RCOM_0679870 localization in plant cells?

To determine the subcellular localization of RCOM_0679870:

  • Fluorescent protein fusion:

    • Create N- and C-terminal GFP/YFP/mCherry fusions

    • Express in plant protoplasts or via transient expression systems

    • Analyze by confocal microscopy

  • Immunolocalization:

    • Generate specific antibodies against RCOM_0679870

    • Perform immunofluorescence on fixed plant tissues

    • Co-localize with known organelle markers

  • Biochemical fractionation:

    • Separate cellular components by differential centrifugation

    • Identify RCOM_0679870 in fractions by western blotting

    • Compare with known markers for different cellular compartments

  • Proximity labeling in situ:

    • Create APEX2 or BioID fusions of RCOM_0679870

    • Express in plant cells and activate labeling

    • Identify biotinylated proteins as proximal interactors

When designing localization experiments, consider:

  • The effect of overexpression on localization patterns

  • Potential interference of tags with targeting signals

  • The need for tissue-specific or developmental timing analysis

How should I analyze RNA-seq data to understand RCOM_0679870 expression patterns?

When analyzing RNA-seq data for RCOM_0679870 expression:

  • Data preprocessing and quality control:

    • Filter low-quality reads

    • Trim adapters

    • Normalize to account for sequencing depth

  • Mapping and quantification:

    • Align reads to the Ricinus communis reference genome

    • Quantify expression using FPKM or TPM values

    • Compare RCOM_0679870 expression with related genes

  • Differential expression analysis:

    • Compare expression across tissues, developmental stages, or treatments

    • Use DESeq2, edgeR, or similar tools for statistical analysis

    • Apply appropriate FDR correction for multiple testing

  • Co-expression network analysis:

    • Identify genes with similar expression patterns

    • Perform GO enrichment analysis on co-expressed genes

    • Infer potential functions based on the "guilt by association" principle

To validate RNA-seq findings:

  • Perform qRT-PCR for RCOM_0679870 in key tissues or conditions

  • Consider protein-level validation with western blotting

  • Examine spatial expression using in situ hybridization or reporter constructs

What statistical approaches are appropriate for analyzing RCOM_0679870 mutant phenotypes?

When analyzing phenotypes of plants with altered RCOM_0679870 expression:

  • Experimental design considerations:

    • Use appropriate controls (wild-type, empty vector)

    • Include multiple independent transgenic lines

    • Ensure adequate biological replicates (n≥3)

    • Control environmental conditions

  • Statistical tests for different data types:

    • Continuous data: t-test (two groups) or ANOVA (multiple groups)

    • Count data: Chi-square or Fisher's exact test

    • Time-series data: repeated measures ANOVA or mixed models

    • Non-parametric alternatives when assumptions aren't met

  • Multiple testing corrections:

    • Bonferroni correction (conservative)

    • Benjamini-Hochberg procedure (FDR control)

    • Tukey's HSD for post-hoc comparisons after ANOVA

  • Effect size calculation:

    • Cohen's d for continuous data

    • Odds ratio for categorical data

    • Reporting confidence intervals alongside p-values

Always clearly state your statistical methods, sample sizes, and any data transformations in your research publications.

What are the current knowledge gaps and future research directions for RCOM_0679870?

Based on the available information, several knowledge gaps and research priorities for RCOM_0679870 include:

  • Functional characterization:

    • Determining the precise biological function

    • Identifying natural substrates or binding partners

    • Understanding its role in plant physiology

  • Structural analysis:

    • Resolving the three-dimensional structure

    • Identifying functional domains and critical residues

    • Understanding membrane topology

  • Regulatory mechanisms:

    • Elucidating transcriptional and post-transcriptional regulation

    • Identifying conditions that induce or repress expression

    • Understanding potential post-translational modifications

  • Physiological context:

    • Determining tissue-specific roles

    • Understanding developmental regulation

    • Identifying environmental responses

Future research should prioritize functional genomics approaches, such as CRISPR/Cas9-mediated gene editing in Ricinus communis, combined with comprehensive phenotyping. Heterologous expression systems could also be valuable for biochemical characterization before moving to the more complex native context.

How can researchers overcome common challenges when working with RCOM_0679870?

Researchers working with RCOM_0679870 may encounter several challenges that can be addressed through systematic approaches:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.