Recombinant Ricinus communis CASP-like protein RCOM_0770240 (RCOM_0770240)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

RCOM_0770240 is a 203-amino acid protein (UniProt ID: B9SV63) with four predicted transmembrane domains. Key specifications include:

PropertyDetails
Source OrganismRicinus communis (castor bean)
Expression SystemE. coli with N-terminal His tag
Amino Acid SequenceMALVNAEKPEVGSSPSSLGPRNKSWVLLMLRFVAFLATAAATIVMAANRETKTFVVATIGSTPIKATVTAKFQHTPAFVFFVIANGMGSIHNLVMIAGDTFVRKFDYKGLRWVTVAILDM LTAALISGGVNAAVFMAELGKNGNSHAKWNKICDRFGSFCDHGGAAIIASFIGLLLMLVI SIISIIKLLKPKSPLVDSHVLAP
Purity>90% (SDS-PAGE)
StorageLyophilized in Tris/PBS buffer with 6% trehalose (pH 8.0); stable at -80°C
Reconstitution0.1–1.0 mg/mL in sterile water, with glycerol (5–50%) for long-term storage

Functional and Evolutionary Context

RCOM_0770240 belongs to the CASPARIAN STRIP MEMBRANE DOMAIN PROTEIN (CASP) family, which mediates lignin polymerization during Casparian strip formation in plant endodermis . Key insights:

  • Structural Role: CASPs form stable transmembrane scaffolds that recruit lignin synthesis machinery .

  • Evolutionary Link: CASP-like (CASPL) proteins share homology with MARVEL domain proteins, a conserved family in eukaryotes involved in membrane organization .

  • Functional Redundancy: In Arabidopsis, CASPLs integrate into CASP membrane domains, suggesting overlapping roles in scaffolding .

Biochemical Properties

  • Transmembrane Domains: Predicted at residues 45–67, 87–109, 130–149, and 169–191 .

  • Thermostability: Retains activity after repeated freeze-thaw cycles when stored with glycerol .

Functional Insights

  • Stress Response: Homologs like ClCASPL (watermelon) and AtCASPL4C1 (Arabidopsis) are induced under cold stress, implicating CASPLs in abiotic stress adaptation .

  • Growth Regulation: AtCASPL4C1 knockout mutants exhibit accelerated vegetative growth and increased biomass, suggesting a role in growth suppression under normal conditions .

In Plant Biology

  • Membrane Domain Studies: Used to investigate CASP-mediated plasma membrane scaffolding .

  • Casparian Strip Assembly: Serves as a model to study lignin deposition mechanisms in root endodermis .

Biotechnological Potential

  • Protein Engineering: The His-tagged recombinant form enables affinity purification for structural studies .

  • Stress Tolerance Screening: Functional analogs in crops (e.g., watermelon) are targets for improving cold tolerance .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please include them in your order remarks. We will then prepare your order accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
RCOM_0770240; CASP-like protein 1B1; RcCASPL1B1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-203
Protein Length
full length protein
Species
Ricinus communis (Castor bean)
Target Names
RCOM_0770240
Target Protein Sequence
MALVNAEKPEVGSSPSSLGPRNKSWVLLMLRFVAFLATAAATIVMAANRETKTFVVATIG STPIKATVTAKFQHTPAFVFFVIANGMGSIHNLVMIAGDTFVRKFDYKGLRWVTVAILDM LTAALISGGVNAAVFMAELGKNGNSHAKWNKICDRFGSFCDHGGAAIIASFIGLLLMLVI SIISIIKLLKPKSPLVDSHVLAP
Uniprot No.

Target Background

Database Links

KEGG: rcu:8283904

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Ricinus communis CASP-like protein RCOM_0770240 and what are its known functional domains?

Ricinus communis CASP-like protein RCOM_0770240 (also known as CASP-like protein 1B1 or RcCASPL1B1) is a protein derived from the castor bean plant (Ricinus communis) . CASP-like proteins generally belong to a family of membrane proteins involved in cell signaling and developmental processes. The specific functional domains of RCOM_0770240 include transmembrane regions and potential protein-protein interaction motifs that facilitate its cellular functions.

The characterization of this protein typically involves domain prediction software, sequence alignment with other CASP-family proteins, and experimental validation through targeted mutations of predicted functional regions. Researchers should note that the commercial form is often available as a partial protein, which may not contain all native functional domains .

Which expression system is optimal for obtaining functional RCOM_0770240 protein for research applications?

The optimal expression system depends on your specific research requirements. From the available data, RCOM_0770240 can be expressed in multiple systems:

Expression SystemAdvantagesBest Used For
E. coliHigh yield, cost-effective, rapid expressionBasic binding studies, antibody production
YeastPost-translational modifications, higher eukaryotic processingFunctional studies requiring limited modifications
BaculovirusComplex eukaryotic processing, high yieldStructural studies, functional assays
Mammalian cellsNative-like post-translational modificationsInteraction studies, functional assays in physiological context
In Vivo Biotinylation in E. coliSite-specific biotinylation via AviTag-BirA technologyProtein-protein interaction studies, pull-down assays

For functional studies that require proper protein folding and post-translational modifications, mammalian or baculovirus expression systems are recommended . If the research involves protein-protein interactions where biotinylation is advantageous, the in vivo biotinylation in E. coli with AviTag-BirA technology would be most appropriate .

What reconstitution and storage conditions preserve RCOM_0770240 activity for extended periods?

For optimal reconstitution of lyophilized RCOM_0770240:

  • Centrifuge the vial briefly to collect the powder at the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Consider adding 5-50% of a stabilizing agent like glycerol to enhance stability

Storage recommendations to maintain protein activity:

Storage ConditionDurationRecommendations
Short-term (≤1 month)2-8°CKeep in buffer with stabilizing agents
Medium-term (≤6 months)-20°CAliquot to avoid freeze-thaw cycles
Long-term (>6 months)-80°CAliquot with 10-15% glycerol as cryoprotectant

Research has shown that repeated freeze-thaw cycles significantly reduce protein activity, so aliquoting is essential for preserving function during long-term storage. For experiments demanding consistent protein activity, validation of functional retention after storage through activity assays is recommended before proceeding with advanced experimental procedures.

How should I design control experiments when studying RCOM_0770240 function in cellular systems?

When designing control experiments for RCOM_0770240 functional studies, a robust experimental design is essential. Following the principles of true experimental research design, ensure your setup includes:

  • Clear identification of independent variables (e.g., protein concentration, treatment duration) and dependent variables (e.g., cellular response, binding affinity)

  • Properly established control and experimental groups with random assignment where possible

  • Adequate replication to enable statistical analysis

Recommended control experiments include:

  • Negative controls: Empty vector-transfected cells or inactive mutant versions of RCOM_0770240

  • Positive controls: Well-characterized related proteins from the CASP family with known functions

  • Dosage controls: Varying concentrations of RCOM_0770240 to establish dose-response relationships

  • Temporal controls: Measurements at multiple time points to capture dynamic responses

For cellular localization studies, compare wild-type protein localization with tagged versions to ensure tag placement doesn't interfere with localization signals. For interaction studies, include non-specific proteins of similar size and charge to confirm specificity of observed interactions .

What experimental approaches are most effective for studying protein-protein interactions involving RCOM_0770240?

For investigating protein-protein interactions involving RCOM_0770240, multiple complementary approaches should be employed:

TechniqueAdvantagesLimitationsBest Application
Co-immunoprecipitationDetects interactions in native contextMay miss transient interactionsVerification of stable interactions
Yeast two-hybridScreens for novel interactorsProne to false positivesInitial discovery of potential interactors
Bioluminescence Resonance Energy Transfer (BRET)Detects interactions in living cellsRequires protein taggingReal-time dynamics of interactions
Surface Plasmon Resonance (SPR)Provides binding kineticsUses purified proteinsQuantitative interaction parameters
Proximity Ligation Assay (PLA)Visualizes interactions in situComplex optimizationSpatial context of interactions

The biotinylated form of RCOM_0770240 produced using AviTag-BirA technology is particularly suited for pulldown assays and SPR studies. For comprehensive characterization, employ at least two orthogonal methods to validate each interaction.

When designing these experiments, ensure random sampling where applicable and carefully control for confounding variables that might affect protein binding, such as pH, ionic strength, and the presence of competing molecules .

What statistical approaches are appropriate for analyzing functional data related to RCOM_0770240?

Statistical analysis of RCOM_0770240 functional data requires careful consideration of experimental design and data characteristics:

  • For comparing treatment groups: Use ANOVA for comparing multiple conditions, followed by appropriate post-hoc tests (e.g., Tukey's for all pairwise comparisons, Dunnett's when comparing to a control)

  • For dose-response relationships: Apply regression analysis to determine EC50/IC50 values and Hill coefficients

  • For time-course experiments: Consider repeated measures ANOVA or mixed-effects models to account for temporal correlation

  • For binding studies: Use non-linear regression to fit appropriate binding models (e.g., one-site binding, cooperative binding)

When presenting statistical results, follow these guidelines:

  • Report exact p-values rather than threshold statements like "p<0.05"

  • Include measures of effect size alongside significance values

  • Present data with appropriate error bars (standard deviation for descriptive statistics, standard error for inferential statistics)

  • Use asterisks or similar symbols in tables to denote statistical significance rather than listing all statistical test values

Remember that the choice of statistical test should be determined before data collection based on your experimental design, not after examining the data distribution .

Advanced Research Applications

When faced with contradictory data across different model systems studying RCOM_0770240, employ these systematic resolution strategies:

  • Source verification:

    • Confirm protein identity through mass spectrometry and sequence verification

    • Validate activity using standardized assays across all systems

    • Ensure equivalent protein states (e.g., post-translational modifications)

  • Methodological standardization:

    • Develop a unified experimental protocol applicable across systems

    • Calibrate assay sensitivities and dynamic ranges

    • Process samples simultaneously when possible to minimize batch effects

  • Context-dependent analysis:

    • Determine if contradictions arise from genuine biological differences between systems

    • Identify system-specific factors (e.g., cofactors, interacting proteins) that might explain divergent results

    • Investigate concentration-dependent effects that might manifest differently across systems

  • Integrative resolution approaches:

    • Employ orthogonal techniques to validate observations

    • Develop mathematical models that incorporate system-specific parameters

    • Design hybrid experiments that bridge differences between systems

Document all variables systematically in comparative tables:

VariableSystem ASystem BSystem CPotential Impact
pH7.26.87.4May affect protein conformation
Expression levelHighLowMediumCould influence stoichiometry of interactions
Cellular backgroundHas cofactor XLacks cofactor XModified cofactor XMay explain differential activity

This systematic comparison often reveals that apparent contradictions actually represent system-specific modulation of protein function rather than irreconcilable results.

What novel approaches can be employed to study the role of RCOM_0770240 in developmental processes?

Investigating RCOM_0770240's role in developmental processes requires integrating cutting-edge technologies with traditional developmental biology approaches:

  • Spatiotemporal expression mapping:

    • Perform single-cell RNA sequencing across developmental stages

    • Generate reporter constructs to visualize expression patterns in vivo

    • Use laser capture microdissection to isolate tissue-specific expression profiles

  • Conditional manipulation systems:

    • Develop inducible expression/knockdown systems (e.g., Tet-On/Off)

    • Employ tissue-specific promoters to restrict manipulation

    • Use optogenetic or chemogenetic tools for temporal control

  • Interaction network characterization:

    • Perform BioID or APEX proximity labeling during key developmental transitions

    • Couple with quantitative proteomics to identify stage-specific interactions

    • Validate key interactions with in situ techniques like PLA

  • Functional impact assessment:

    • Apply CRISPR/Cas9-mediated genome editing for precise modifications

    • Conduct phenotypic analysis at multiple scales (molecular, cellular, tissue, organism)

    • Perform rescue experiments with domain-specific mutants to map functional regions

Data integration is critical when studying developmental roles. Consider establishing a multi-parameter database structure:

Developmental StageExpression LevelLocalizationKey InteractorsPhenotypic Impact of Manipulation
Early embryogenesisHigh in mesodermal precursorsPerinuclearFactors A, B, CDisrupted tissue specification
Mid-developmentRestricted to developing vasculatureCell membraneFactors D, EAbnormal vascular branching
Late developmentLow, specific to specialized cellsCytoplasmic punctaFactors F, GImpaired terminal differentiation

This comprehensive approach provides a four-dimensional understanding (3D space + time) of RCOM_0770240's developmental functions.

Challenges in Data Interpretation

When interpreting contradictory functional data for RCOM_0770240, consider these methodological and biological factors:

  • Protein-specific considerations:

    • Verify protein integrity and activity in each experimental system

    • Confirm that tag placement doesn't interfere with function

    • Evaluate concentration-dependent effects that might explain divergent results

  • Methodological factors:

    • Assess sensitivity and specificity of different detection methods

    • Consider kinetic parameters that might cause time-dependent discrepancies

    • Evaluate whether experimental conditions (pH, salt, temperature) affect protein behavior

  • Biological context:

    • Determine if cell/tissue type influences function through differential partner availability

    • Consider developmental stage-specific effects

    • Evaluate species-specific differences in protein function

  • Data integration approach:

    • Create a decision matrix weighing evidence quality

    • Consider developing a unifying model that encompasses apparently contradictory observations

    • Design critical experiments specifically targeted at resolving contradictions

A systematic framework for evaluating contradictory data:

ObservationExperimental SystemMethodologyReplicationPossible Confounding FactorsResolution Strategy
Activates pathway XIn vitro purified systemDirect enzymatic assayReplicated in 3 labsLacks cellular contextTest with cell extracts
Inhibits pathway XCell-based assayReporter gene readoutSingle studyPotential off-target effectsValidate with alternative readouts
No effect on pathway XIn vivo modelPhenotypic assessmentReplicated in 2 labsComplex compensatory mechanismsTest in conditional knockout

This structured evaluation often reveals that contradictions reflect genuine biological complexity rather than experimental artifacts.

How can I ensure reproducibility in complex experimental setups involving RCOM_0770240?

Ensuring reproducibility in complex RCOM_0770240 experiments requires methodological rigor across experimental design, execution, analysis, and reporting:

  • Experimental design considerations:

    • Perform power analysis to determine appropriate sample sizes

    • Implement randomization and blinding where applicable

    • Include all necessary controls (positive, negative, technical)

    • Pre-register experimental protocols and analysis plans

  • Standardized protocols:

    • Develop detailed standard operating procedures (SOPs)

    • Specify critical parameters (e.g., protein concentration, buffer composition)

    • Document lot numbers and sources of key reagents

    • Include quality control checkpoints

  • Data analysis standardization:

    • Apply consistent processing pipelines

    • Use version-controlled analysis scripts

    • Establish predetermined exclusion criteria

    • Validate results with alternative analytical approaches

  • Comprehensive reporting:

    • Document all experimental conditions in detail

    • Report both positive and negative results

    • Present raw data alongside processed results

    • Follow field-specific reporting guidelines

Implementation table for reproducibility measures:

PhaseCritical ElementsDocumentation ApproachValidation Method
DesignSample size calculation, control selectionPre-registration documentPeer review of design
ExecutionProtocol adherence, quality checksElectronic lab notebook with timestampsIndependent verification
AnalysisData processing steps, statistical testsVersion-controlled scripts with commentsAlternative analysis methods
ReportingComplete methods, all resultsSupplementary materials, data repositoriesReproducibility checklist

For protein-specific considerations, include protein characterization data (purity, activity) with each experimental batch, and maintain reference standards across experiments to calibrate results between runs .

What emerging technologies could advance understanding of RCOM_0770240 function beyond current methodologies?

Several cutting-edge technologies show promise for elucidating RCOM_0770240 functions beyond traditional approaches:

  • Advanced structural biology techniques:

    • Cryo-electron microscopy for visualizing protein complexes in native states

    • Integrative structural biology combining multiple data sources (NMR, SAXS, XL-MS)

    • AlphaFold2 and other AI-based structure prediction with experimental validation

  • Single-molecule approaches:

    • Single-molecule FRET to detect conformational changes upon binding

    • Optical tweezers to measure mechanical properties and force-dependent interactions

    • Super-resolution microscopy for tracking dynamic behavior in live cells

  • Systems biology integration:

    • Multi-omics approaches correlating proteomic, transcriptomic, and metabolomic changes

    • Network modeling to place RCOM_0770240 in its broader functional context

    • Machine learning algorithms to predict functional impacts of mutations

  • Spatially-resolved technologies:

    • Spatial transcriptomics to map expression patterns with subcellular resolution

    • Proximity proteomics with subcellular targeting

    • Tissue-specific interactome mapping using in vivo crosslinking

Implementation timeline for emerging technologies:

TechnologyCurrent LimitationsDevelopment NeededPotential ImpactTimeframe
Cryo-EM analysisProtein size limitationsSample preparation optimizationHigh-resolution structural insightsShort-term
AI-integrated structure predictionValidation requirementsExperimental feedback loopsRapid functional domain mappingMedium-term
Spatial multi-omicsTechnical complexityIntegrated analysis pipelinesContextualized function in tissuesLong-term

These emerging approaches will enable a more comprehensive understanding of RCOM_0770240 by connecting molecular mechanisms to cellular and organismal functions across spatial and temporal dimensions.

How might comparative analysis across species inform our understanding of RCOM_0770240 evolution and function?

Comparative analysis across species provides valuable insights into RCOM_0770240 evolution and functional conservation:

  • Evolutionary trajectory analysis:

    • Construct phylogenetic trees of CASP-like proteins across diverse species

    • Identify evolutionary rate shifts that might indicate functional diversification

    • Map domain acquisitions/losses to major evolutionary transitions

  • Functional conservation assessment:

    • Perform cross-species complementation experiments

    • Test functional interchangeability of domains between orthologs

    • Identify lineage-specific interaction partners

  • Integrated comparative approaches:

    • Correlate evolutionary conservation with structural features

    • Map selection pressure across protein domains to identify functionally critical regions

    • Analyze co-evolution patterns with interaction partners

  • Ecological context integration:

    • Correlate protein features with species-specific ecological adaptations

    • Analyze expression patterns across species in equivalent developmental contexts

    • Identify environmental factors that might drive functional divergence

Comparative analysis data integration framework:

SpeciesProtein Identity to HumanKey Domain VariationsTissue Expression PatternKnown FunctionsUnique Features
Human100%Complete domain setBrain, kidney, liverFunction A, BUnique C-terminal motif
Mouse92%Shortened linker regionBrain, kidneyFunction AExtended N-terminus
Zebrafish78%Missing domain XDeveloping brainFunction BNovel domain Z
Drosophila45%Core domains onlyNeuronal precursorsAncestral function CSimpler architecture

This comparative approach places RCOM_0770240 in an evolutionary context, distinguishing conserved ancestral functions from more recently evolved specialized roles.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.