Recombinant Ricinus communis CASP-like protein RCOM_0837390 (RCOM_0837390)

Shipped with Ice Packs
In Stock

Description

Protein Overview

RCOM_0837390 is a recombinant protein produced via heterologous expression systems. Key features include:

PropertyDetails
UniProt IDB9S8Z3
Source OrganismRicinus communis (castor bean)
Expression HostEscherichia coli (E. coli)
TagN-terminal His tag
Protein LengthFull-length (1-191 amino acids)
Molecular Weight~22 kDa (calculated)
Purity>90% (SDS-PAGE)
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)

Biological Role

  • CASP-like proteins act as scaffolds to recruit lignin polymerization machinery during Casparian strip formation, ensuring selective nutrient absorption and barrier functions in roots .

  • RCOM_0837390 shares structural homology with Arabidopsis CASP1, suggesting analogous roles in membrane domain stabilization .

Evolutionary Context

  • CASPL (CASP-like) proteins are evolutionarily conserved across land plants and green algae, with homology to the MARVEL protein family in fungi and animals .

  • Phylogenetic analysis groups RCOM_0837390 within the CASPL clade, characterized by transmembrane domain conservation .

Expression Systems

  • E. coli: Primary host for high-yield production (~0.1–1.0 mg/mL post-reconstitution) .

  • Purification: Affinity chromatography via His tag, followed by lyophilization for long-term storage .

Research Applications

  • Antibody Production: Used as an immunogen for ELISA and Western blot assays .

  • Functional Studies: Investigates CASP-mediated lignin deposition and root barrier dynamics .

  • Structural Biology: Assists in resolving CASP scaffold architecture via crystallography or cryo-EM .

Current Research and Future Directions

  • Functional Validation: Studies in Lotus japonicus demonstrate that CASPLs with the EL1 motif can localize to Casparian strips in heterologous systems, hinting at conserved regulatory mechanisms .

  • Stress Response: Ongoing work explores RCOM_0837390’s role in abiotic stress tolerance, leveraging RNA-seq data showing root-specific expression .

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will then fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us and we will prioritize its development.
Synonyms
RCOM_0837390; Casparian strip membrane protein 4; RcCASP4
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-191
Protein Length
full length protein
Species
Ricinus communis (Castor bean)
Target Names
RCOM_0837390
Target Protein Sequence
MKTGSVEAGEQASEDATPRRGKKLNRGILILDLVLRVFGAICTLGSAVAMGTTSQTLPSS SQFFRFRAKYNDLPMFMFFAIANSIVCAYLVLSLRLSIFHIIRSAGIITRIILVTFDMVM LVLLTCGASAATSIVYLAHKGNASANWLPFCVRFSHFCNRISGSLIGSFFSIIIFMLLVI LSAVSQFSICN
Uniprot No.

Target Background

Function
This protein regulates membrane-cell wall junctions and localized cell wall deposition. It is essential for establishing the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis. The Casparian strips act as an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm, preventing lateral diffusion.
Database Links

KEGG: rcu:8281830

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Ricinus communis CASP-like protein RCOM_0837390 and what are its key characteristics?

Ricinus communis CASP-like protein RCOM_0837390 (also known as RcCASP4 or Casparian strip membrane protein 4) is a full-length protein comprising 191 amino acids. It belongs to the CASP family of proteins, which are involved in the formation of Casparian strips in plant roots, critical structures that regulate nutrient and water uptake.

The protein has the following key characteristics:

  • UniProt ID: B9S8Z3

  • Source organism: Ricinus communis (castor bean plant)

  • Function: Associated with Casparian strip membrane formation

  • Length: 191 amino acids

The protein contains hydrophobic domains typical of membrane-associated proteins, suggesting it has a role in membrane organization and barrier formation in plant tissues. As a CASP family protein, it likely contributes to the selective permeability of plant cellular barriers.

What expression systems are optimal for producing recombinant RCOM_0837390?

Expression SystemAdvantagesDisadvantagesRecommended for RCOM_0837390
E. coliFast growth, high yield, cost-effectiveLimited post-translational modificationsBasic structural studies, antibody production
YeastProper protein folding, some post-translational modificationsModerate yieldFunctional studies requiring proper folding
Insect cellsAdvanced eukaryotic modifications, proper foldingHigher cost, longer production timeStudies requiring native-like structure
Mammalian cellsFull range of post-translational modificationsHighest cost, lowest yieldStudies of complex interactions with other proteins

What are the recommended storage and handling protocols for RCOM_0837390 to maintain protein stability?

Proper storage and handling of RCOM_0837390 are crucial for maintaining its stability and functionality. Based on established protocols, the following recommendations should be followed:

  • Storage conditions:

    • Store lyophilized protein at -20°C/-80°C upon receipt

    • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% recommended) for long-term storage

    • Aliquot for long-term storage at -20°C/-80°C

  • Buffer considerations:

    • The protein is typically provided in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

    • This buffer composition helps maintain protein stability and prevent aggregation

Researchers should note that repeated freeze-thaw cycles significantly reduce protein activity and should be avoided. For experimental work requiring multiple uses, creating small single-use aliquots is strongly recommended.

How can researchers assess the functional activity of recombinant RCOM_0837390 in experimental settings?

Assessing the functional activity of RCOM_0837390 requires specialized approaches given its role as a membrane protein involved in Casparian strip formation. Researchers can employ several methodologies:

  • Membrane integration assays:

    • Liposome incorporation studies to assess membrane insertion capability

    • Fluorescent tagging (e.g., GFP fusion) to visualize membrane localization

    • Proteoliposome reconstitution to assess functional integration

  • Protein interaction studies:

    • Co-immunoprecipitation to identify binding partners

    • Yeast two-hybrid screening to detect protein-protein interactions

    • Surface plasmon resonance (SPR) to quantify binding kinetics

  • Functional complementation:

    • Expression in CASP-deficient plant models to assess functional rescue

    • Evaluation of barrier function restoration in plant tissue

  • Structural assessment:

    • Circular dichroism (CD) spectroscopy to analyze secondary structure

    • Limited proteolysis to identify domain organization and flexibility

    • Cross-linking studies to evaluate oligomerization potential

These methodologies should be selected based on the specific research question, with consideration of the protein's membrane-associated nature. When designing functional assays, researchers should also consider the potential impact of the His-tag on protein function and include appropriate controls.

What are the challenges in studying RCOM_0837390's role in Casparian strip formation and how can they be addressed?

Studying RCOM_0837390's role in Casparian strip formation presents several challenges due to the complex nature of this biological structure and the technical difficulties in working with membrane proteins. Key challenges and solutions include:

ChallengeDescriptionMethodological Solution
Membrane protein solubilityMembrane proteins like RCOM_0837390 are hydrophobic and prone to aggregationUse detergents or amphipols for solubilization; employ nanodiscs for structural studies
Functional assessment in vitroDifficult to recreate the complex environment of the Casparian stripDevelop simplified model systems using artificial membranes or reconstituted components
Visualization of protein localizationStandard microscopy may not provide sufficient resolutionEmploy super-resolution microscopy or electron microscopy with immunogold labeling
Multiple protein interactionsCasparian strip formation involves numerous proteins acting in concertUse systems biology approaches and protein interaction networks

Additionally, researchers face challenges related to:

  • Expression systems: Prokaryotic expression systems may not properly fold plant membrane proteins . To address this, consider:

    • Using plant-based expression systems

    • Optimizing codon usage for the expression host

    • Employing fusion partners to enhance solubility

  • Contradictory data resolution: When faced with conflicting results, researchers should:

    • Systematically vary experimental conditions to identify context-dependent effects

    • Employ multiple complementary techniques to validate findings

    • Consider species-specific differences in CASP protein function

  • Translational challenges: Moving from in vitro to in vivo studies requires:

    • Development of appropriate transgenic plant models

    • Careful phenotypic analysis of mutant lines

    • Correlation of molecular findings with physiological outcomes

By addressing these challenges through methodological innovation and careful experimental design, researchers can gain deeper insights into RCOM_0837390's role in Casparian strip formation.

What are common expression and purification challenges for RCOM_0837390 and how can researchers overcome them?

Researchers working with RCOM_0837390 may encounter several challenges during expression and purification processes. These challenges and their solutions are outlined below:

  • Expression challenges:

    • Hydrophobicity: As a membrane protein, RCOM_0837390 contains hydrophobic regions that can cause aggregation during expression
      Solution: Use solubility-enhancing fusion tags (e.g., SUMO, MBP) or optimize expression conditions (temperature, inducer concentration)

    • Codon usage: Rare codons in the Ricinus communis sequence may reduce expression efficiency in prokaryotic systems
      Solution: Use codon-optimized synthetic genes or specialized E. coli strains with rare tRNA genes

  • Truncated product formation:

    • Premature translation termination can result in incomplete proteins
      Solution: Use expression vectors with fusion tags at both N and C termini to facilitate identification and purification of full-length protein

    • Proteolysis during expression or purification
      Solution: Add protease inhibitors during cell lysis and purification steps; reduce expression time or temperature

  • Purification challenges:

    • Poor solubility in aqueous buffers
      Solution: Include appropriate detergents (such as mild non-ionic detergents like DDM or CHAPS) in purification buffers

    • Non-specific binding during affinity chromatography
      Solution: Optimize imidazole concentration in wash buffers; consider using a step gradient for elution

  • Protein quality control:

    • Ensure protein integrity through SDS-PAGE analysis (should show >90% purity)

    • Verify identity through Western blotting or mass spectrometry

    • Assess homogeneity through size exclusion chromatography

By anticipating these challenges and implementing appropriate strategies, researchers can improve the yield and quality of recombinant RCOM_0837390 for their experimental studies.

How can researchers analyze contradictory data regarding RCOM_0837390 function and resolve discrepancies in experimental results?

When faced with contradictory data regarding RCOM_0837390 function, researchers should employ a systematic approach to identify the source of discrepancies and resolve conflicts in experimental results:

  • Data review and validation:

    • Construct a comprehensive data matrix comparing all experimental conditions and results

    • Identify specific variables that differ between contradictory experiments

    • Evaluate the robustness of statistical analyses applied to each dataset

  • Methodological analysis:

    • Compare protein preparation methods (expression system, purification protocol, storage conditions)

    • Assess experimental techniques (in vitro vs. in vivo, biochemical vs. structural approaches)

    • Evaluate the potential impact of fusion tags on protein function

  • Systematic conflict resolution:

    • Design controlled experiments that directly address contradictions

    • Perform side-by-side comparisons using identical reagents and protocols

    • Consider third-party validation through collaborative studies

  • Advanced analytical approaches:

    • Apply meta-analysis techniques to quantitatively assess conflicting datasets

    • Use computational modeling to reconcile seemingly contradictory findings

    • Consider context-dependent functions that may explain different experimental outcomes

  • Philosophical framework for contradiction resolution:

    • Apply dialectical thinking to contradictory findings, recognizing that opposing results may reflect different aspects of complex biological systems

    • Consider that contradictions may lead to deeper understanding of protein function in different contexts

By systematically analyzing conflicting data and identifying the specific conditions under which different results are obtained, researchers can develop a more nuanced understanding of RCOM_0837390's structure-function relationships and biological roles.

What are the potential applications of RCOM_0837390 in advanced plant biology research and biotechnology?

RCOM_0837390, as a CASP-like protein involved in Casparian strip formation, offers several promising applications in advanced plant biology research and biotechnology:

  • Agricultural biotechnology applications:

    • Engineering plants with modified nutrient uptake efficiency through CASP protein modulation

    • Developing crops with enhanced tolerance to soil contaminants by altering barrier properties

    • Creating plants with improved water use efficiency through optimized root barrier function

  • Fundamental biology research:

    • Using RCOM_0837390 as a model to study membrane protein assembly and organization

    • Investigating the evolution of apoplastic barriers in different plant lineages

    • Exploring the role of CASP proteins in environmental stress responses

  • Biomimetic applications:

    • Designing artificial semi-permeable membranes inspired by Casparian strip architecture

    • Developing biosensors based on CASP protein structure and function

    • Creating model systems for studying membrane domain organization

  • Drug development potential:

    • Utilizing knowledge of CASP proteins for developing compounds that modify plant barrier properties

    • Exploring potential parallels between plant and animal barrier tissues for translational research

By exploring these research directions, scientists can leverage our understanding of RCOM_0837390 to address challenges in agriculture, biotechnology, and fundamental plant biology.

How can advanced structural biology techniques be applied to elucidate RCOM_0837390's molecular mechanisms?

Advanced structural biology techniques offer powerful approaches to elucidate the molecular mechanisms of RCOM_0837390. Researchers can employ the following methodologies:

TechniqueResolution RangeSample RequirementsKey Advantages for RCOM_0837390 Studies
Cryo-EM2-4 Å~0.1 mg purified proteinCan visualize protein in membrane environment
X-ray Crystallography1-3 Å>5 mg crystallizable proteinHighest resolution for atomic details
NMR Spectroscopy2-5 Å5-20 mg isotope-labeled proteinProvides dynamics information
Computational ModelingN/ASequence informationCan predict structures in different states

These advanced structural biology approaches, used individually or in combination, can provide critical insights into RCOM_0837390's membrane integration, protein-protein interactions, and functional mechanisms in Casparian strip formation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.