Recombinant Ricinus communis CASP-like protein RCOM_0864260 (RCOM_0864260)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly include it in your order notes, and we will prepare the product accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributors for specific delivery time information.
All protein shipments are defaulted to include standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is advisable to add 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life of the protein is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
RCOM_0864260; CASP-like protein 2B1; RcCASPL2B1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-202
Protein Length
full length protein
Species
Ricinus communis (Castor bean)
Target Names
RCOM_0864260
Target Protein Sequence
MSYLGVGVSPGNVPVYHGSNLKVIDKRVRLAELVLRCLICGLGVLAAVLVGTDTQVKEIF SIQKKARFTDMKALVFLVIANGIAAAYSLLQGVRCVVGMVRGSALFSKPLAWAIFSGDQM MAYLTVAAVAAAAQSAVFAKLGQPELQWMKICNMYGKFCNQVGEGIASALLVSVSMVVLS CISAFSLFRLYGANKGKDCTRW
Uniprot No.

Target Background

Database Links

KEGG: rcu:8282856

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How should RCOM_0864260 recombinant protein be stored and reconstituted for experimental use?

The recombinant protein should be stored as a lyophilized powder at -20°C to -80°C upon receipt. For reconstitution, the protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of glycerol to a final concentration of 5-50% is recommended before aliquoting for long-term storage at -20°C/-80°C, with 50% being the standard recommendation by suppliers.

Researchers should be aware that repeated freeze-thaw cycles can degrade protein quality, so working aliquots should be stored at 4°C for up to one week to minimize degradation. Prior to opening, vials should be briefly centrifuged to ensure all material is collected at the bottom .

What is the expression system used for producing recombinant RCOM_0864260?

The recombinant RCOM_0864260 protein is expressed in Escherichia coli. This bacterial expression system is widely used for producing recombinant proteins due to its rapid growth, high protein yields, and relatively low cost. The protein is tagged with a histidine sequence (His-tag) at the N-terminus, which facilitates purification using metal affinity chromatography.

For researchers developing purification protocols, it's important to note that the recombinant protein is stored in a Tris/PBS-based buffer containing 6% trehalose at pH 8.0, which helps maintain protein stability during storage .

What cellular functions has RCOM_0864260 been associated with in transcriptome studies?

Transcriptome analyses have revealed that RCOM_0864260 is significantly downregulated (fold change of -5.64) in response to UV-B treatment in plant studies. This suggests its potential role in UV-B stress response mechanisms. The protein has been categorized alongside other membrane-associated proteins, indicating a possible role in cellular compartmentalization or membrane function .

CASP-like proteins in plants are generally associated with the formation of Casparian strips in the endodermis, which are critical barriers controlling the movement of water and solutes into the vascular tissues. Therefore, RCOM_0864260 may be involved in regulating water and solute transport in Ricinus communis, particularly under stress conditions .

How does RCOM_0864260 relate to other differentially expressed genes in stress response pathways?

In transcriptome studies examining UV-B response, RCOM_0864260 was found downregulated alongside other proteins involved in membrane function and cellular stress responses. The table below shows comparative expression data for selected genes from UV-B treated samples:

Gene IDFold ChangeProtein Description
g15215-6.21protein LSD1 isoform X2
g10248-5.64CASP-like protein RCOM_0864260
g11089-5.21abscisic acid receptor PYL2
g18749-5.20CASP-like protein 6
g3051-5.75WAT1-related protein At1g09380
g17284-5.893-ketoacyl-CoA synthase 6-like

This pattern of co-regulation suggests RCOM_0864260 may function within a network of genes involved in stress adaptation, particularly in relation to abscisic acid signaling (PYL2) and membrane modification (3-ketoacyl-CoA synthase 6-like) .

What are the key experimental design considerations when studying RCOM_0864260 function in plant stress responses?

When designing experiments to study RCOM_0864260 function in stress responses, researchers should:

  • Define clear variables: Establish independent variables (e.g., UV-B exposure, drought, temperature) and dependent variables (protein expression levels, phenotypic changes).

  • Establish proper controls: Include both positive controls (known stress-responsive genes) and negative controls (non-responsive genes) alongside RCOM_0864260.

  • Consider temporal dynamics: Design time-course experiments to capture the dynamic nature of stress responses, as CASP-like proteins may show temporal expression patterns.

  • Address confounding variables: Control for developmental stage, tissue specificity, and circadian rhythms which can affect stress-responsive gene expression.

  • Use appropriate stress conditions: Ensure UV-B treatment parameters (wavelength: 253.7 nm; intensity: 75 μW cm−2) or other stress conditions are carefully calibrated and monitored throughout the experiment .

What methods are recommended for measuring RCOM_0864260 expression levels?

For accurate measurement of RCOM_0864260 expression levels, researchers should consider a multi-method approach:

  • RNA-Seq Analysis: High-throughput sequencing provides comprehensive expression data. Previous studies achieved 41-42 million mapped reads with quality values >30 for 93-94% of nucleotides, with GC percentages between 39-42%. This approach allows detection of subtle expression changes in response to treatments .

  • qRT-PCR Validation: Follow RNA-Seq with quantitative real-time PCR for validation, using gene-specific primers designed for RCOM_0864260. Select stable reference genes appropriate for the experimental conditions.

  • Protein Detection Methods: Use Western blotting with antibodies against the His-tag or the protein itself to confirm translation. For recombinant protein studies, SDS-PAGE analysis can confirm purity greater than 90% .

  • Subcellular Localization: Employ fluorescently tagged constructs to track protein localization, particularly in membrane structures, given the protein's suggested role in cellular compartmentalization.

What bioinformatic approaches should be used for analyzing RCOM_0864260 in transcriptomic datasets?

When analyzing RCOM_0864260 in transcriptomic datasets, researchers should implement the following bioinformatic approaches:

  • Quality Control and Pre-processing: Filter raw reads for quality (aim for Q30% > 93%) and remove adapters. In previous studies, clean read rates ranged from 96-98%, with no unknown nucleotides (N% = 0) .

  • Differential Expression Analysis: Use established packages (e.g., DESeq2, edgeR) to identify significant expression changes, considering a logarithmic fold change threshold (typically |log2FC| > 1) and adjusted p-value (p < 0.05).

  • Functional Annotation:

    • GO analysis to categorize RCOM_0864260 into cellular components, biological processes, and molecular functions

    • KEGG pathway analysis to place the protein in metabolic contexts

    • Protein family (Pfam) database searches to identify conserved domains

  • Co-expression Network Analysis: Identify genes with similar expression patterns to RCOM_0864260, potentially revealing functional relationships or regulatory networks.

  • Comparative Analysis: Compare expression across different tissues, developmental stages, or stress conditions to establish specificity of response .

How can protein-protein interaction studies with RCOM_0864260 be designed and optimized?

For studying protein-protein interactions involving RCOM_0864260, researchers should consider:

  • Yeast Two-Hybrid Screening: Use the recombinant protein as bait to screen for interacting partners, particularly those involved in membrane organization or stress response pathways.

  • Co-Immunoprecipitation (Co-IP): Leverage the His-tag on the recombinant protein for pull-down assays, followed by mass spectrometry to identify binding partners. Optimize buffer conditions (consider the Tris/PBS buffer at pH 8.0 used for storage) to maintain native conformation .

  • Bimolecular Fluorescence Complementation (BiFC): For in vivo validation of interactions, particularly for membrane-associated complexes.

  • Surface Plasmon Resonance (SPR): Quantify binding kinetics between RCOM_0864260 and potential partners, immobilizing the His-tagged protein on a sensor chip.

  • Cross-linking Mass Spectrometry: To capture transient interactions that may occur during stress responses.

Consider that the protein's membrane association may require specialized detergents during extraction to maintain structural integrity while allowing for protein interaction studies.

What approaches can be used to investigate the relationship between RCOM_0864260 expression and metabolic variations in plants?

To investigate relationships between RCOM_0864260 expression and metabolic variations:

  • Integrated Omics Approach: Combine transcriptomics, proteomics, and metabolomics data to correlate RCOM_0864260 expression with specific metabolic changes. This integration should follow experimental design principles with clear independent and dependent variables .

  • Metabolic Pathway Analysis: Focus on pathways potentially regulated by membrane integrity changes, particularly:

    • Water and solute transport pathways

    • Stress-responsive metabolite production

    • Lipid metabolism (given the co-regulation with 3-ketoacyl-CoA synthase)

  • Genetic Modification Approaches:

    • Overexpression studies to observe metabolic consequences

    • RNAi or CRISPR-based knockdowns to assess essential metabolic functions

    • Complementation studies in heterologous systems

  • Isotope Labeling Experiments: Track metabolic fluxes in wildtype versus modified RCOM_0864260 expression lines to identify specific affected pathways.

  • Environmental Response Studies: Design treatments that mimic natural stress conditions (UV-B, drought, temperature) and monitor both gene expression and metabolite levels using GC-MS or LC-MS approaches .

How should contradictory data regarding RCOM_0864260 function be approached and resolved?

When faced with contradictory data regarding RCOM_0864260 function:

  • Systematic Methodology Review:

    • Compare experimental conditions across studies (UV-B wavelength, intensity, exposure time)

    • Evaluate biological variability (plant varieties, growth conditions, developmental stages)

    • Assess technical reproducibility and statistical robustness

  • Cross-validation Using Multiple Techniques:

    • Validate RNA-Seq findings with qRT-PCR

    • Confirm protein-level changes with Western blotting

    • Use both in vitro and in vivo approaches for functional studies

  • Meta-analysis Approach:

    • Compile data from multiple studies

    • Perform statistical analysis accounting for inter-study variability

    • Identify consistent trends versus outlier results

  • Tissue and Cell-Type Specificity:

    • Conduct cell-type specific analyses as CASP-like proteins may have different functions in different tissues

    • Use laser capture microdissection for precise tissue sampling if necessary

  • Time-Course Resolution:

    • Implement high-resolution time-course experiments to capture transient responses

    • Consider that RCOM_0864260 may have biphasic responses to stress (early upregulation followed by downregulation) .

What are the most promising avenues for future research on RCOM_0864260?

Future research on RCOM_0864260 should focus on:

  • Structural Biology Approaches: Determine the three-dimensional structure of RCOM_0864260 to understand its membrane association and potential interaction surfaces.

  • Comparative Studies Across Species: Investigate homologs in other plants to establish evolutionary conservation and divergence of function, particularly focusing on stress-tolerant species.

  • Systems Biology Integration: Place RCOM_0864260 within larger regulatory networks to understand its position in stress response hierarchies and potential as a stress-response biomarker.

  • Climate Change Adaptation Studies: Examine RCOM_0864260 expression across varying environmental conditions relevant to climate change scenarios, particularly increased UV exposure and drought.

  • CRISPR-Based Genome Editing: Create precise modifications to study structure-function relationships in RCOM_0864260 and assess phenotypic consequences in planta .

How can high-throughput screening approaches be optimized for studying RCOM_0864260 interactions with chemical compounds?

For high-throughput screening of RCOM_0864260 interactions with chemical compounds:

  • Protein Stability Assays: Implement thermal shift assays to identify compounds that stabilize protein conformation, suggesting binding.

  • Fluorescence-Based Interaction Assays: Develop FRET or fluorescence polarization assays using the recombinant protein, which can be reconstituted according to the specified protocol (0.1-1.0 mg/mL in deionized water) .

  • Surface Plasmon Resonance Arrays: Immobilize His-tagged RCOM_0864260 on sensor chips for parallel screening of multiple compounds.

  • In Silico Screening Followed by Validation: Use computational docking studies based on predicted or determined structures to prioritize compounds for experimental validation.

  • Careful Controls and Validation:

    • Include positive controls (known interactors)

    • Implement orthogonal validation methods for hit compounds

    • Consider the membrane-associated nature of the protein when designing assay conditions

What are the key research insights about RCOM_0864260 that researchers should consider for experimental planning?

Researchers planning experiments with RCOM_0864260 should consider:

  • Membrane Association: As a CASP-like protein, RCOM_0864260 likely plays roles in membrane organization and compartmentalization, requiring appropriate experimental approaches for membrane-associated proteins.

  • Stress Responsiveness: The significant downregulation (-5.64 fold change) in response to UV-B indicates a role in stress adaptation, suggesting experiments should incorporate various stress conditions beyond UV-B .

  • Co-regulated Gene Networks: RCOM_0864260 functions within a network of stress-responsive genes, including abscisic acid receptors and membrane-modifying enzymes, indicating potential roles in hormone signaling and membrane remodeling.

  • Experimental Design Considerations:

    • Clear definition of variables

    • Appropriate controls

    • Multi-omics integration

    • Time-course analyses to capture dynamic responses

  • Technical Specifications: When using recombinant protein, researchers should follow storage (−20°C/−80°C) and reconstitution guidelines (0.1-1.0 mg/mL in deionized water with 5-50% glycerol) to ensure experimental reproducibility .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.