Recombinant Ricinus communis CASP-like protein RCOM_1206790 (RCOM_1206790)

Shipped with Ice Packs
In Stock

Description

Functional Insights and Research Context

While no direct studies on RCOM_1206790 exist, its classification within the CASP family suggests potential roles analogous to other CASPs:

CASP Family Functions

CASP proteins are critical for forming the Casparian strip (CS), a hydrophobic barrier in endodermal cells that regulates ion transport and water uptake. Key functions include:

  • Stress Response: Modulating plant adaptation to drought, salinity, and nutrient deficiencies .

  • Endodermal Development: Enabling selective ion permeability by membrane domain formation .

ELISA-Based Studies

Recombinant RCOM_1206790 is employed in enzyme-linked immunosorbent assays (ELISAs) to quantify protein expression or antibody specificity. Commercial kits (e.g., CSB-CF498225RMM) provide standardized protocols for antigen-antibody detection .

Hypothetical Use Cases

  1. Plant Stress Biology: Investigating RCOM_1206790’s role in castor bean responses to environmental stressors.

  2. Membrane Protein Interactions: Studying its interactions with transporters or signaling molecules in endodermal cells.

  3. Structural Biology: Solving its 3D structure to identify conserved or novel functional domains.

Research Gaps and Future Directions

  1. Functional Characterization: No studies directly link RCOM_1206790 to CS formation or stress responses.

  2. Expression Patterns: Tissue-specific expression data (e.g., root vs. shoot) remain unexplored.

  3. Ortholog Comparisons: Comparative analysis with Arabidopsis or rice CASPs (e.g., AtCASP_like1/31) could reveal functional conservation .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery information.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
RCOM_1206790; CASP-like protein 4D1; RcCASPL4D1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Ricinus communis (Castor bean)
Target Names
RCOM_1206790
Target Protein Sequence
MAPPPPSLASRMAALILRILTFIFLIASLVILTTNTATLELDLVEVKVHFKDVYAYRYML ATIVIGLAYTVLQIAFTLYYVATGNRMMSGDGNLAFDFFGDKVISYILVTGAAAGFASTK DIKPVFSGSGDFDAFINKGYASASLLLIGFVCTAVLSVFSSYALPKQV
Uniprot No.

Target Background

Database Links

KEGG: rcu:8267759

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Basic Research Questions

  • What is RCOM_1206790 and what family of proteins does it belong to?

    RCOM_1206790 is a CASP-like protein found in Ricinus communis (castor bean plant). It belongs to the CASP (Casparian strip membrane proteins) family, which are specialized proteins involved in the generation of plasma membrane domains and the modification of cell walls in plants . The protein is also known by synonyms such as CASP-like protein 4D1 and RcCASPL4D1, with UniProt ID B9SXY8 . CASP-like proteins are part of a larger repertoire of proteins that are potentially involved in creating specialized membrane domains throughout the plant kingdom and directing localized cell wall modifications .

  • What is the functional significance of CASP-like proteins in plants?

    CASP-like proteins play crucial roles in plant cellular architecture and function. They are currently the only known proteins capable of forming membrane fences in plants and are essential for directing local cell wall modifications . In particular, they are involved in the formation of Casparian strips, specialized cell wall modifications that create paracellular diffusion barriers in the endodermis of plant roots.

    Studies on related proteins like OsCASP1 in rice have shown that these proteins orchestrate Casparian strip formation and suberin deposition, which are critical for nutrient homeostasis and adaptation to growth environments . The emergence of specific CASP signatures in the plant kingdom correlates with the appearance of Casparian strips, suggesting evolutionary conservation of this important function .

  • How does RCOM_1206790 compare to other CASP-like proteins in different species?

    Comparative analysis reveals that RCOM_1206790 shares structural similarities with other CASP-like proteins across plant species. The CASP protein family shows conservation between CASPLs and the MARVEL protein family, with conserved residues predominantly located in transmembrane domains .

    In rice, for example, there are 6 OsCASPs and 28 OsCASPLs, with OsCASP1 being well-studied for its role in Casparian strip formation . Unlike RCOM_1206790 (168 amino acids), the related protein RCOM_0680180 is slightly larger at 192 amino acids, suggesting potential functional differences .

    Some CASP proteins contain a specific nine-amino acid signature (ESLPFFTQF) in their first extracellular loop, which is associated with endodermis-specific function. This signature is absent in more primitive plants like Physcomitrella patens and Selaginella moellendorffii, correlating with the absence of Casparian strips in these species .

Intermediate Research Questions

  • What are the optimal storage and reconstitution protocols for recombinant RCOM_1206790?

    For optimal preservation and experimental reproducibility, RCOM_1206790 requires specific handling protocols:

    Storage Protocol:

    • Store the lyophilized powder at -20°C/-80°C upon receipt

    • Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles

    • Working aliquots can be stored at 4°C for up to one week

    • Repeated freezing and thawing is not recommended

    Reconstitution Methodology:

    1. Briefly centrifuge the vial prior to opening to bring contents to the bottom

    2. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    3. Add glycerol to a final concentration of 5-50% (50% is recommended as default)

    4. Aliquot for long-term storage at -20°C/-80°C

    The protein is typically supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during storage .

  • What expression systems are most effective for producing functional RCOM_1206790?

    E. coli is the predominant expression system used for recombinant production of RCOM_1206790 . This bacterial expression system offers several methodological advantages:

    • High protein yield for structural and functional studies

    • Cost-effective production compared to eukaryotic systems

    • Well-established protocols for induction and purification

    • Compatibility with N-terminal His-tagging for simplified purification

    For functional studies, researchers should consider that protein expressed in bacterial systems may lack post-translational modifications present in the native plant protein. When designing experiments to study RCOM_1206790 function, it's important to validate whether such modifications are necessary for activity.

    Expression in plant-based systems could be considered for studies requiring native-like modifications, though these would require more complex methodological approaches and typically yield lower protein amounts.

  • What experimental techniques are most reliable for studying CASP-like protein localization?

    Several complementary techniques have proven effective for studying the localization of CASP-like proteins:

    TechniqueApplicationAdvantagesConsiderations
    Immunostaining with GFP antibodiesDetection of GFP-tagged CASP proteins in plant tissuesHigh specificity when properly controlledRequires careful negative controls to avoid false positives
    Fluorescent protein fusionsLive imaging of protein localizationAllows dynamic studies in living tissuesFusion may affect protein trafficking or function
    Translational GFP fusions with native promotersStudying endogenous expression patternsReflects native temporal and spatial expressionRequires knowledge of promoter regions
    Transmission electron microscopy (TEM)Ultrastructural analysis of protein localizationHigh resolution of membrane domainsLabor-intensive sample preparation
    ClearSee solution with fluorescent stainingWhole-mount observation of structures like Casparian stripsAllows visualization in thick tissuesOptimization required for different plant species

    When studying RCOM_1206790 localization, it's critical to include appropriate controls and consider multiple complementary approaches to validate findings, as different methodologies may yield apparently contradictory results .

  • How can researchers effectively analyze the purity and integrity of recombinant RCOM_1206790?

    Multiple analytical methods should be employed to ensure proper quality control of recombinant RCOM_1206790:

    1. SDS-PAGE Analysis: The primary method to assess protein purity, with commercial preparations typically exceeding 90% purity . For reliable results:

      • Use appropriate percentage gels (12-15%) for this relatively small protein (168 amino acids)

      • Include molecular weight standards appropriate for the expected size range

      • Consider both reducing and non-reducing conditions to assess potential disulfide bonding

    2. Western Blotting: For specific detection and verification:

      • Anti-His antibodies can detect the N-terminal His-tag

      • Specific antibodies against RCOM_1206790, if available, provide confirmation of identity

    3. Mass Spectrometry:

      • MALDI-TOF or ESI-MS to confirm the exact molecular weight

      • Peptide mass fingerprinting after tryptic digestion for sequence verification

    4. Functional Assays:

      • Membrane binding assays to verify the protein's ability to associate with membranes

      • Oligomerization analysis to assess potential complex formation

    For researchers requiring especially high purity for structural studies, additional purification steps beyond the initial IMAC purification may be necessary, such as size exclusion chromatography or ion exchange chromatography.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.