Recombinant Ricinus communis CASP-like protein RCOM_1446020 (RCOM_1446020)

Shipped with Ice Packs
In Stock

Description

Production and Purification

This recombinant protein is produced using Escherichia coli expression systems, followed by affinity chromatography for purification .

Key Production Metrics

ParameterSpecification
Expression HostE. coli
Purity>90% (verified by SDS-PAGE)
FormLyophilized powder
Storage BufferTris/PBS-based buffer with 6% trehalose, pH 8.0
ReconstitutionSterile deionized water; 0.1–1.0 mg/mL with 5–50% glycerol for stability

Biochemical Stability and Handling

Optimal storage conditions and stability are critical for experimental reproducibility:

ConditionRecommendation
Short-Term Storage4°C (up to 1 week for working aliquots)
Long-Term Storage-20°C/-80°C (avoid repeated freeze-thaw cycles)
Stability EnhancersGlycerol (50% final concentration recommended)

Research Applications

RCOM_1446020 is primarily utilized in structural and functional studies of plant membrane proteins. Examples include:

  • ELISA Development: Commercial ELISA kits leverage this protein for quantitative assays targeting CASP-like proteins .

  • Protein Interaction Studies: Used in pull-down assays and yeast two-hybrid systems to identify binding partners .

Functional Insights

While direct functional data for RCOM_1446020 remains limited, CASP proteins generally facilitate:

  • Barrier Formation: Critical for Casparian strip development in plant roots.

  • Ion Transport Regulation: Mediates selective nutrient uptake and stress responses.

Limitations and Future Directions

Current research gaps include:

  • In Vivo Functional Data: No peer-reviewed studies on RCOM_1446020’s specific role in Ricinus communis.

  • Structural Resolution: Lack of crystallographic or cryo-EM data for this isoform.

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order remarks. We will prepare the product according to your specifications.
Lead Time
Delivery time may vary depending on the purchasing method and location. We kindly request that you consult your local distributors for specific delivery time estimates.
Please note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life for the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize development according to your specifications.
Synonyms
RCOM_1446020; CASP-like protein 1F2; RcCASPL1F2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Ricinus communis (Castor bean)
Target Names
RCOM_1446020
Target Protein Sequence
MITSIATTTAGAFEVKSLGFIPYPSQPKRIFFMAQVIFRILAIAFAVASISAMVTSDQNV IVFGMDTAARYSYSSAFRFLVGANAVVCGFSVLSLIFVCLMSRRSEAILEKNYYLFLHDM VMMVMMVSGCSAATAIGYVGRYGEKEITWTAVCDFVGKFCNQALVSIVLAYLALFCYVAL TTLAAHKLNHSSSTAAIRQNE
Uniprot No.

Target Background

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How does RCOM_1446020 compare structurally to other CASP-like proteins in plants?

RCOM_1446020 belongs to the CASP-like protein family found across various plant species. When comparing to other CASP-like proteins such as RCOM_0680180 (another CASP-like protein from Ricinus communis), there are notable structural similarities and differences:

FeatureRCOM_1446020RCOM_0680180
Length201 amino acids192 amino acids
UniProt IDB9RH17B9RT04
SynonymCASP-like protein 1F2 (RcCASPL1F2)CASP-like protein 1E1 (RcCASPL1E1)
Sequence similarityReferenceSome conservation in transmembrane regions

Both proteins share characteristic membrane-spanning domains typical of CASP-like proteins, but RCOM_1446020 has unique sequence features that likely contribute to its specific functional properties . Comparative analysis with other plant CASP-like proteins indicates conserved domains that may be critical for membrane integration and protein function.

What are the critical controls needed when designing experiments with RCOM_1446020?

When designing experiments involving RCOM_1446020, researchers should implement the following control strategies:

  • Negative controls: Include samples without RCOM_1446020 (buffer only or irrelevant protein of similar size/tag) to establish baseline responses and identify non-specific effects.

  • Positive controls: Use well-characterized proteins with known activity in your experimental system to validate assay functionality.

  • Vehicle controls: Include appropriate buffer controls containing the same concentration of storage components (Tris/PBS-based buffer, 6% trehalose, pH 8.0) to account for potential buffer effects .

  • Tag controls: Since RCOM_1446020 is often used with a His-tag, include controls with His-tagged non-relevant proteins to distinguish between protein-specific and tag-specific effects .

  • Concentration gradients: Test multiple concentrations of RCOM_1446020 to establish dose-response relationships and determine optimal working concentrations.

The experimental design should isolate the variable of interest while controlling for all other potential influencing factors, following standard principles for testing a hypothesis through a series of controlled experiments .

How should researchers approach experimental design when investigating RCOM_1446020 protein-protein interactions?

When investigating protein-protein interactions involving RCOM_1446020, researchers should follow this methodological framework:

  • Preliminary screening: Use computational predictions and literature review to identify potential interacting partners based on known CASP-like protein interactions.

  • In vitro binding assays: Employ pull-down assays using His-tagged RCOM_1446020 as bait to capture potential interaction partners from cell lysates.

  • Confirmation methods: Validate interactions using complementary techniques:

    • Co-immunoprecipitation (Co-IP)

    • Yeast two-hybrid screening

    • Surface plasmon resonance (SPR)

    • Biolayer interferometry

  • Mapping interaction domains: Design truncated versions of RCOM_1446020 to identify specific regions responsible for protein-protein interactions.

  • Functional validation: Assess the biological relevance of identified interactions through functional assays measuring changes in cellular processes when the interaction is disrupted.

Researchers should carefully design controls for each experiment, including non-interacting proteins as negative controls and known protein pairs as positive controls to ensure specificity and sensitivity of the interaction detection methods .

What are the optimal storage conditions for maintaining RCOM_1446020 stability and activity?

Optimal storage conditions for RCOM_1446020 require careful consideration of temperature, buffer composition, and handling procedures:

  • Long-term storage: Store at -20°C/-80°C with aliquoting recommended to avoid repeated freeze-thaw cycles that could compromise protein integrity .

  • Buffer conditions: The protein is typically stored in a Tris/PBS-based buffer with 6% trehalose at pH 8.0. For extended storage, adding glycerol to a final concentration of 50% is recommended .

  • Working aliquots: For ongoing experiments, working aliquots can be stored at 4°C for up to one week to minimize freeze-thaw degradation .

  • Reconstitution protocol:

    • Briefly centrifuge the vial before opening to collect contents at the bottom

    • Reconstitute lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol (5-50% final concentration) for improved stability

  • Quality monitoring: Periodically assess protein integrity using SDS-PAGE to ensure the protein remains intact during storage.

Adherence to these storage protocols is critical for maintaining protein activity and ensuring experimental reproducibility across different studies .

What quality control methods should be employed to verify RCOM_1446020 integrity before experimental use?

To ensure RCOM_1446020 integrity and functionality before experimental use, researchers should implement the following quality control procedures:

  • SDS-PAGE analysis: Verify protein purity and molecular weight (expected ≥90% purity) to confirm absence of degradation products or contaminating proteins .

  • Western blot: Confirm protein identity using anti-His antibodies or specific antibodies against RCOM_1446020 if available.

  • Mass spectrometry: For definitive identification and to verify the intact mass of the protein, confirming the amino acid sequence is as expected.

  • Functional assays: Develop and employ specific activity assays relevant to the known or hypothesized function of CASP-like proteins.

  • Circular dichroism (CD) spectroscopy: Assess secondary structure integrity, particularly useful for monitoring batch-to-batch consistency.

  • Dynamic light scattering (DLS): Detect potential aggregation or oligomerization that might affect experimental outcomes.

How can researchers effectively design experiments to elucidate RCOM_1446020 function in membrane biology?

Designing experiments to investigate RCOM_1446020's membrane-related functions requires a multi-faceted approach:

  • Subcellular localization studies:

    • Employ fluorescently tagged RCOM_1446020 constructs for live-cell imaging

    • Perform subcellular fractionation followed by western blotting

    • Use immunoelectron microscopy for high-resolution localization within membrane structures

  • Membrane integration analysis:

    • Conduct protease protection assays to determine topology

    • Use alkaline extraction to differentiate between peripheral and integral membrane association

    • Perform liposome reconstitution experiments to assess direct membrane interactions

  • Functional membrane assays:

    • Measure membrane permeability changes in the presence of RCOM_1446020

    • Analyze lipid composition alterations in membranes containing the protein

    • Assess ion or metabolite transport across membranes

  • Structure-function relationships:

    • Generate site-directed mutants targeting predicted transmembrane regions

    • Examine how mutations affect membrane localization and function

    • Use chimeric constructs with other CASP-like proteins to identify functional domains

For each experimental approach, researchers should include appropriate controls, such as membrane proteins with known functions and non-membrane proteins as negative controls .

What methodological approaches can distinguish between direct and indirect effects of RCOM_1446020 in cellular pathways?

Distinguishing between direct and indirect effects of RCOM_1446020 in cellular pathways requires sophisticated experimental design:

  • Temporal resolution studies:

    • Utilize inducible expression systems to monitor immediate versus delayed responses

    • Perform time-course experiments with high temporal resolution

    • Apply mathematical modeling to differentiate primary from secondary effects

  • Proximity-based interaction mapping:

    • Implement BioID or APEX2 proximity labeling to identify proteins in close physical proximity

    • Use FRET or BRET-based assays to detect direct interactions in real-time

    • Apply crosslinking mass spectrometry (XL-MS) to capture transient interactions

  • Genetic interaction profiling:

    • Conduct synthetic genetic array (SGA) analysis in model organisms

    • Implement CRISPR screens to identify genetic dependencies

    • Perform epistasis analysis with known pathway components

  • Direct biochemical validation:

    • Purify interacting protein complexes for in vitro reconstitution

    • Conduct enzyme assays with purified components

    • Perform surface plasmon resonance to measure binding kinetics

  • Control strategies:

    • Use catalytically inactive mutants to separate structural from functional roles

    • Apply specific inhibitors to block individual steps in the pathway

    • Implement rescue experiments with orthologous proteins to confirm specificity

These approaches should be applied in conjunction to build a comprehensive understanding of RCOM_1446020's direct effects versus downstream consequences in cellular pathways .

How should researchers approach comparative studies between RCOM_1446020 and other CASP-like proteins?

Effective comparative studies between RCOM_1446020 and other CASP-like proteins require a structured methodological approach:

  • Sequence-based comparative analysis:

    • Perform multiple sequence alignments to identify conserved domains and variable regions

    • Construct phylogenetic trees to establish evolutionary relationships

    • Use algorithms to predict shared structural elements versus unique features

  • Structural comparison methods:

    • Generate structural models using homology modeling or structural prediction tools

    • Compare predicted or determined structures to identify functional domains

    • Analyze conservation of key structural features across CASP-like proteins

  • Functional conservation testing:

    • Design complementation experiments to test functional interchangeability

    • Perform domain swapping between RCOM_1446020 and related proteins

    • Assess conservation of interaction partners across different CASP-like proteins

  • Expression pattern analysis:

    • Compare tissue-specific or condition-dependent expression patterns

    • Analyze promoter regions for conserved regulatory elements

    • Perform co-expression analysis to identify shared regulatory networks

When comparing RCOM_1446020 with RCOM_0680180 (another CASP-like protein from Ricinus communis), researchers should note differences in length (201 aa vs. 192 aa) and sequence composition that may contribute to functional divergence while maintaining core CASP-like properties .

What methodological considerations are important when investigating the potential role of RCOM_1446020 in cellular stress responses?

When investigating RCOM_1446020's potential role in cellular stress responses, researchers should consider these methodological approaches:

  • Stress induction protocols:

    • Apply standardized stress conditions (oxidative, osmotic, temperature, nutrient deprivation)

    • Use dose-response and time-course experiments to capture dynamic responses

    • Include recovery phases to assess reversibility of effects

  • Protein expression and modification analysis:

    • Monitor RCOM_1446020 expression levels under various stress conditions

    • Examine post-translational modifications using phospho-specific antibodies or mass spectrometry

    • Assess protein stability and turnover rates during stress

  • Genetic manipulation approaches:

    • Generate knockout/knockdown lines to assess loss-of-function phenotypes under stress

    • Create overexpression lines to evaluate gain-of-function effects

    • Develop stress-specific inducible expression systems

  • Cellular phenotype assessment:

    • Measure standard stress response indicators (ROS levels, membrane integrity)

    • Analyze subcellular localization changes during stress

    • Evaluate metabolic adaptations using metabolomics approaches

  • Control considerations:

    • Include wild-type controls exposed to identical stress conditions

    • Test related CASP-like proteins to identify specific versus general responses

    • Validate findings across multiple cell types or tissues when possible

This methodological framework enables systematic investigation of RCOM_1446020's role in stress responses while distinguishing between specific functions and general cellular adaptation mechanisms .

What are the common technical challenges in expressing and purifying functional RCOM_1446020, and how can researchers overcome them?

Researchers face several technical challenges when expressing and purifying RCOM_1446020, primarily due to its membrane-associated nature. Here are effective solutions:

  • Expression system selection challenges:

    • Challenge: Low expression levels in standard E. coli systems

    • Solution: Optimize codon usage for E. coli, use specialized strains (C41(DE3), C43(DE3)) designed for membrane protein expression, or consider eukaryotic expression systems for proper post-translational modifications

  • Protein solubility issues:

    • Challenge: Formation of inclusion bodies due to hydrophobic transmembrane domains

    • Solution: Express with solubility-enhancing tags (SUMO, MBP), optimize induction conditions (lower temperature, reduced IPTG concentration), or develop refolding protocols from inclusion bodies

  • Purification complications:

    • Challenge: Maintaining protein stability during extraction from membranes

    • Solution: Screen detergent panels to identify optimal extraction conditions, use mild detergents like DDM or LMNG, and include stabilizing agents such as glycerol or specific lipids

  • Functional verification difficulties:

    • Challenge: Confirming that purified protein retains native conformation

    • Solution: Develop activity assays specific to CASP-like proteins, use circular dichroism to verify secondary structure, and implement thermal shift assays to assess protein stability

  • Tag interference concerns:

    • Challenge: His-tag affecting protein function or structure

    • Solution: Compare tagged and tag-cleaved versions when possible, position tag at alternative terminus if function is compromised, or use alternative tagging strategies

These technical solutions have been successfully applied to membrane proteins with similar characteristics to RCOM_1446020 and can significantly improve yield and quality of the purified protein .

How can researchers design experiments to resolve contradictory data regarding RCOM_1446020 function?

When faced with contradictory data regarding RCOM_1446020 function, researchers should implement a systematic troubleshooting approach:

  • Standardize experimental conditions:

    • Develop a detailed standard operating procedure (SOP) for RCOM_1446020 handling

    • Control environmental variables (temperature, pH, ionic strength)

    • Establish consistent protein batches with verified quality metrics

  • Methodological triangulation:

    • Apply multiple independent techniques to address the same research question

    • Prioritize complementary methods with different underlying principles

    • Evaluate whether contradictions are technique-dependent

  • Parameter sensitivity analysis:

    • Systematically vary experimental parameters to identify critical variables

    • Perform concentration gradients to detect threshold-dependent effects

    • Test time-dependence to capture dynamic or transient functions

  • Independent validation:

    • Engage collaborating laboratories to independently replicate key experiments

    • Implement blinded experimental designs to minimize bias

    • Use different protein preparations to assess batch-to-batch variability

  • Granular hypothesis refinement:

    • Develop sub-hypotheses that can distinguish between competing models

    • Design critical experiments specifically targeted at points of contradiction

    • Implement Bayesian experimental design to maximize information gain

  • Contextual dependency assessment:

    • Test function in different cellular or biochemical contexts

    • Evaluate whether contradictions arise from context-dependent activities

    • Consider physiological relevance of experimental conditions

This methodological framework allows researchers to systematically resolve contradictions and develop a more nuanced understanding of RCOM_1446020 function across different experimental contexts .

What are the most promising methodological approaches for elucidating the complete functional profile of RCOM_1446020?

Based on current knowledge and technological capabilities, the most promising approaches for comprehensively characterizing RCOM_1446020 function include:

  • Integrative structural biology:

    • Combining X-ray crystallography, cryo-EM, and NMR spectroscopy to resolve structure

    • Implementing molecular dynamics simulations to understand dynamic behaviors

    • Applying hydrogen-deuterium exchange mass spectrometry to map conformational changes

  • Systems biology approaches:

    • Multi-omics integration (proteomics, transcriptomics, metabolomics) to place RCOM_1446020 in broader cellular context

    • Network analysis to identify functional modules containing RCOM_1446020

    • Mathematical modeling to predict system-level consequences of RCOM_1446020 perturbation

  • Advanced genetic manipulation:

    • CRISPR-based precise genome editing to create domain-specific mutations

    • Conditional expression systems to control RCOM_1446020 activity in specific tissues or developmental stages

    • Synthetic biology approaches to engineer novel functions based on RCOM_1446020 domains

  • In vivo imaging technologies:

    • Super-resolution microscopy to visualize subcellular dynamics

    • Förster resonance energy transfer (FRET) sensors to monitor protein-protein interactions in real-time

    • Optogenetic tools to manipulate RCOM_1446020 activity with spatiotemporal precision

These integrated approaches, applied in a coordinated research program, offer the best path toward understanding the complete functional profile of RCOM_1446020 and its role in plant biology .

How should researchers interpret RCOM_1446020 findings in the broader context of plant membrane biology?

When interpreting findings about RCOM_1446020, researchers should consider the following contextual frameworks:

  • Evolutionary perspective:

    • Place findings within the evolutionary history of CASP-like proteins across plant species

    • Consider whether RCOM_1446020 functions represent conserved or species-specific adaptations

    • Evaluate findings in light of Ricinus communis's unique biology and ecological niche

  • Membrane biology integration:

    • Connect RCOM_1446020 functions to broader principles of plant membrane organization

    • Consider interactions with membrane lipid composition and microdomain organization

    • Evaluate potential roles in membrane trafficking pathways and organelle communication

  • Stress response context:

    • Interpret functions in relation to known plant stress response mechanisms

    • Consider how RCOM_1446020 may contribute to cellular homeostasis under stress conditions

    • Evaluate potential applications in enhancing plant stress resilience

  • Methodological limitations awareness:

    • Acknowledge constraints of in vitro studies versus in vivo functions

    • Consider how heterologous expression systems might influence observed functions

    • Recognize the need for validation across multiple experimental platforms

  • Translational potential:

    • Evaluate findings for potential applications in plant biotechnology

    • Consider how RCOM_1446020 knowledge might inform approaches to improving crop traits

    • Identify potential biomarkers or targets for agricultural applications

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.