Recombinant Ricinus communis CASP-like protein RCOM_1491260 (RCOM_1491260)

Shipped with Ice Packs
In Stock

Description

Functional Role in Plant Biology

RCOM_1491260 is a CASP-like protein implicated in:

  • Membrane Domain Formation: CASP proteins scaffold plasma membrane domains, critical for Casparian strip assembly in endodermal cells .

  • Stress Adaptation: Homologs like AtCASPL4C1 in Arabidopsis regulate cold tolerance and growth dynamics, suggesting RCOM_1491260 may contribute to abiotic stress responses .

  • Cell Wall Modification: CASPs interact with peroxidases to direct lignin deposition, a mechanism likely conserved across plant species .

Experimental Use Cases

  • Protein-Protein Interaction Studies: Used to investigate CASP-mediated membrane scaffolding and peroxidase binding .

  • Stress Response Assays: Functional analogs in Arabidopsis and watermelon demonstrate roles in cold tolerance, enabling comparative studies .

  • Structural Biology: AlphaFold-predicted models facilitate computational studies on transmembrane domain dynamics .

Comparative Analysis with CASP Family Members

SpeciesProteinKey FunctionReference
ArabidopsisAtCASPL4C1 (At3g55390)Cold tolerance, growth regulation
Oryza sativaOsCASP_like11/19Ion transport, Casparian strip formation
Ricinus communisRCOM_1491260Membrane scaffolding (inferred)

Research Gaps and Future Directions

  • Functional Validation: Direct evidence linking RCOM_1491260 to Casparian strip formation or stress adaptation is limited.

  • Ortholog Studies: Cross-species expression (e.g., in Arabidopsis) could clarify conserved roles .

  • Structural Dynamics: Cryo-EM or X-ray crystallography may validate AlphaFold predictions .

Key Citations

  • CASP-mediated membrane domain formation .

  • Recombinant production and commercial availability .

  • Structural modeling via AlphaFold .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
RCOM_1491260; CASP-like protein 3A1; RcCASPL3A1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-214
Protein Length
full length protein
Species
Ricinus communis (Castor bean)
Target Names
RCOM_1491260
Target Protein Sequence
MTNGQKIEVAVQLPESKVAATENNETMSGPLVVGGGVAKPFGRKADVMHVILRLLCTITS VTAVSFMVTAHQSSTVSIYGFMLPVRSKWSFSHSFEYLVGVSAAVAAHSLLQLLISMSRL LRKSPVIPSRSHAWLIFAGDQVFAYAMISAGAAASGVTNLNRTGIQHTALPNFCKPLNYF CNHVAVSIAFAFISCLLLAALAVQEVIWLSKSKY
Uniprot No.

Target Background

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is RCOM_1491260 and what is its role in Ricinus communis?

RCOM_1491260 is a Casparian strip domain-like protein (CASP-like protein) found in Ricinus communis (castor bean). Based on homology with other CASP proteins, it likely functions as a scaffold protein involved in the formation of Casparian strips in root endodermal cells. CASP proteins typically localize to the Casparian strip membrane domain (CSD) where they facilitate lignin deposition to create a barrier that regulates water and nutrient movement between soil and vascular tissues. The protein consists of 214 amino acids and is available commercially as a recombinant protein with an N-terminal His-tag expressed in E. coli .

How does RCOM_1491260 compare structurally and functionally to other CASP-like proteins?

RCOM_1491260 belongs to a larger family of CASP and CASP-like proteins found across plant species. While specific comparative data for RCOM_1491260 is limited in the available literature, we can draw parallels with better-characterized CASP proteins. In rice, there are 6 OsCASPs and 28 OsCASPLs, with OsCASP1 showing high sequence similarity to Arabidopsis AtCASP1-4 . These proteins share a conserved module for membrane subdomain formation and typically show tissue-specific expression patterns. CASP-like proteins may have diverse functions in different tissues, with some involved in cell wall modification processes beyond Casparian strip formation .

The following table summarizes key structural features of related CASP-like proteins:

ProteinSpeciesLength (aa)Expression SystemTagFunction
RCOM_1491260Ricinus communis214E. coliHisPresumed role in Casparian strip formation
RCOM_0680180Ricinus communis192E. coliHisCASP-like protein, similar predicted function
OsCASP1Oryza sativaNot specifiedNot specifiedNot specifiedRequired for Casparian strip formation in endodermal cells

What are the optimal conditions for handling recombinant RCOM_1491260?

Based on handling recommendations for similar recombinant proteins (such as RCOM_0680180), the following protocols should be observed when working with recombinant RCOM_1491260:

  • Storage: Store at -20°C/-80°C upon receipt. Aliquot for multiple use to avoid repeated freeze-thaw cycles .

  • Working Conditions: Working aliquots may be stored at 4°C for up to one week .

  • Reconstitution: Before opening, briefly centrifuge to bring contents to the bottom. Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Add 5-50% glycerol (final concentration) for long-term storage .

  • Quality Control: Expect purity greater than 90% as determined by SDS-PAGE .

  • Buffer Conditions: Typically supplied in Tris/PBS-based buffer with 6% Trehalose at pH 8.0 .

What experimental approaches are most effective for studying RCOM_1491260 function in vivo?

Several methodological approaches can be employed to study RCOM_1491260 function in vivo:

  • Gene Editing: CRISPR-Cas9 knockout or knockdown strategies to assess loss-of-function phenotypes, particularly focusing on Casparian strip formation and barrier function in roots.

  • Protein Localization: Fluorescent protein tagging (GFP fusion) or immunolocalization using specific antibodies to determine subcellular localization, with particular attention to potential localization at the Casparian strip membrane domain.

  • Barrier Function Assays: Using apoplastic tracers (e.g., propidium iodide) to assess barrier integrity in wild-type versus RCOM_1491260-modified plants.

  • Protein-Protein Interaction Studies: Yeast two-hybrid, co-immunoprecipitation, or bimolecular fluorescence complementation to identify interaction partners. Based on studies of other CASP proteins, potential interactors may include other CASP family members, lignin biosynthetic enzymes, and regulatory proteins .

  • Complementation Studies: Expressing RCOM_1491260 in Arabidopsis casp mutants to test for functional complementation across species.

How should researchers design data tables for experiments involving RCOM_1491260?

When designing data tables for experiments involving RCOM_1491260, researchers should follow these guidelines:

  • Clear Title: Include a descriptive title that indicates the purpose of the experiment (e.g., "Effect of Salt Stress on RCOM_1491260 Expression Levels") .

  • Variables Organization: Place the independent variable (what you're changing) in the left column and dependent variables (what you're measuring) in subsequent columns .

  • Units: Clearly indicate units of measurement for all variables .

  • Replication: Include multiple trials and a derived quantity column (often average) to ensure statistical validity .

  • Formatting: Ensure consistent formatting throughout the table, with clear headers and organized rows and columns .

Example table structure for gene expression analysis:

Treatment ConditionRCOM_1491260 Expression (Relative Units)Average Expression
Trial 1Trial 2Trial 3
Control
Salt Stress (150mM)
Drought (-0.5 MPa)

What analytical techniques are most effective for characterizing RCOM_1491260 structure and interactions?

Several analytical techniques can be employed for comprehensive characterization of RCOM_1491260:

  • Structural Analysis:

    • X-ray crystallography or cryo-electron microscopy for high-resolution structural determination

    • Circular dichroism to assess secondary structure elements

    • Membrane protein NMR for dynamics and interaction studies

  • Interaction Analysis:

    • Surface plasmon resonance for quantitative binding studies

    • Cross-linking mass spectrometry to identify interaction interfaces

    • Fluorescence resonance energy transfer (FRET) for in vivo interaction studies

  • Functional Analysis:

    • Reconstitution in artificial membrane systems to study membrane domain organization

    • Lignin polymerization assays to assess scaffold function

    • In planta imaging of barrier formation using appropriate stains and microscopy techniques

  • Post-translational Modifications:

    • Mass spectrometry-based approaches to identify and quantify modifications

    • Site-directed mutagenesis of potential modification sites to assess functional importance

How does RCOM_1491260 contribute to plant stress responses and adaptation?

While specific information about RCOM_1491260's role in stress responses is not directly provided in the search results, we can draw insights from studies of related CASP-like proteins:

  • Salt Stress Adaptation: The maize protein ZmSTL1, which localizes to the Casparian strip domain, plays a role in salt tolerance. Mutations in this gene impair lignin deposition at the endodermal Casparian strip domain, leading to defective barrier function . RCOM_1491260 might play a similar role in Ricinus communis, regulating ion movement across the endodermis under salt stress.

  • Cold Stress Response: Studies with AtCASPL4C1 in Arabidopsis show that knockout plants exhibit earlier flowering, while overexpression of its ortholog from Citrullus lanatus (CICASPL) results in increased sensitivity to cold stress . This suggests CASP-like proteins may have roles in temperature stress responses.

  • Nutrient Homeostasis: OsCASP1 plays an important role in nutrient homeostasis and adaptation to growth environments . RCOM_1491260 likely contributes to similar processes in Ricinus communis through its role in barrier formation.

  • Root System Architecture: The complex root structure in rice, which includes specialized tissues not present in Arabidopsis (such as exodermis, sclerenchyma, and aerenchyma), allows adaptation to growth conditions . RCOM_1491260 may contribute to the development or function of specialized root tissues in Ricinus communis.

What are the challenges in analyzing RCOM_1491260 interactions with other proteins in the Casparian strip formation pathway?

Several technical and biological challenges exist when studying RCOM_1491260 interactions:

  • Membrane Protein Complexes: As a membrane-localized protein, RCOM_1491260 presents challenges for traditional interaction studies due to its hydrophobic nature and requirements for membrane integrity.

  • Temporal Dynamics: Casparian strip formation is a dynamic process with temporally regulated protein interactions. Capturing these interactions at the right developmental stage requires precise timing.

  • Spatial Resolution: The Casparian strip domain is a highly specialized membrane domain. Distinguishing interactions within this domain from non-specific membrane associations requires high spatial resolution techniques.

  • Complex Formation: Studies of OsCASP1 indicate it can form complexes with itself and OsCASP2 . RCOM_1491260 likely participates in similar homooligomeric and heterooligomeric complexes, adding complexity to interaction analyses.

  • Tissue Accessibility: The endodermis is an internal tissue layer, making in vivo imaging and biochemical isolation of native complexes technically challenging.

  • Limited Ricinus communis Resources: Compared to model plants like Arabidopsis, fewer genetic tools and resources are available for Ricinus communis, complicating functional genomics approaches.

How can genetic modification approaches be optimized for studying RCOM_1491260 function?

To optimize genetic modification approaches for studying RCOM_1491260, researchers should consider:

  • Vector Design: Create constructs with tissue-specific or inducible promoters to control expression in specific cell types or developmental stages. For localization studies, careful consideration of tag position is essential to avoid disrupting protein function.

  • CRISPR-Cas9 Optimization: Design multiple sgRNAs targeting different regions of the RCOM_1491260 gene to increase knockout efficiency. Consider multiplex editing if functional redundancy with other CASP family members is suspected.

  • Reporter Systems: Develop reporter constructs (e.g., promoter:GUS fusions) to monitor expression patterns under different conditions or in different genetic backgrounds.

  • Complementation Strategies: For functional validation, design complementation constructs using the native promoter and terminator sequences to ensure proper expression patterns.

  • Heterologous Systems: Consider expressing RCOM_1491260 in model systems like Arabidopsis thaliana, particularly in casp mutant backgrounds, to assess functional conservation and take advantage of well-established protocols.

  • Transformation Methods: Optimize transformation protocols specifically for Ricinus communis tissues, considering factors such as explant selection, Agrobacterium strains, and selection markers.

How should researchers approach data interpretation when comparing RCOM_1491260 with other CASP-like proteins?

When comparing RCOM_1491260 with other CASP-like proteins, researchers should:

  • Consider Evolutionary Context: Analyze phylogenetic relationships to understand the evolutionary history of CASP-like proteins across species. This provides context for functional similarities and differences.

  • Assess Structural Conservation: Compare protein sequences focusing on conserved domains, transmembrane regions, and potential interaction motifs. The function of CASP proteins depends on a conserved module for membrane subdomain formation .

  • Examine Expression Patterns: Compare tissue-specific and developmental expression patterns. CASP-like proteins are expressed in tissue-specific manners across different plant species .

  • Evaluate Functional Complementation: Test whether RCOM_1491260 can functionally replace other CASP proteins when expressed heterologously, and vice versa.

  • Consider Species-Specific Root Anatomy: Different plant species have distinct root anatomical features. Rice, for example, has a more complex root structure than Arabidopsis, including exodermis, sclerenchyma, and aerenchyma tissues not present in Arabidopsis . These anatomical differences may influence CASP protein function.

  • Analyze Protein Complexes: Compare the ability to form homo-oligomeric and hetero-oligomeric complexes. OsCASP1, for example, can form complexes with itself and OsCASP2 .

What statistical considerations are important when analyzing phenotypic data from RCOM_1491260 studies?

When analyzing phenotypic data from RCOM_1491260 studies, researchers should consider:

  • Experimental Design: Ensure proper replication (both biological and technical), randomization, and inclusion of appropriate controls to minimize bias and experimental error.

  • Sample Size Determination: Conduct power analysis to determine the appropriate sample size needed to detect biologically meaningful effects with statistical confidence.

  • Data Distribution: Assess whether data follows normal distribution before applying parametric tests. For non-normally distributed data, consider non-parametric alternatives or appropriate data transformations.

  • Multiple Comparisons: When testing multiple hypotheses or comparing multiple groups, apply appropriate corrections (e.g., Bonferroni, Benjamini-Hochberg) to control for false discovery rate.

  • Mixed-Effects Models: Consider using mixed-effects models when analyzing data with multiple sources of variation (e.g., genotype, treatment, time point, tissue type).

  • Correlation Analysis: For studies examining relationships between variables (e.g., gene expression and phenotypic traits), use appropriate correlation methods and avoid inferring causation from correlation alone.

  • Reproducibility: Validate key findings in independent experiments and, when possible, using complementary methodological approaches.

What are common technical issues when working with recombinant RCOM_1491260 and how can they be resolved?

Researchers working with recombinant RCOM_1491260 may encounter several technical challenges:

  • Protein Solubility Issues:

    • Problem: As a membrane protein, RCOM_1491260 may show limited solubility when expressed recombinantly.

    • Solution: Optimize expression conditions (lower temperature, slower induction), use detergents appropriate for membrane proteins, or consider fusion tags that enhance solubility.

  • Protein Degradation:

    • Problem: Unstable protein leading to degradation during purification or storage.

    • Solution: Include protease inhibitors during purification, avoid repeated freeze-thaw cycles, aliquot upon receipt, and store at -20°C/-80°C as recommended .

  • Reconstitution Difficulties:

    • Problem: Aggregation or precipitation upon reconstitution from lyophilized form.

    • Solution: Follow recommended reconstitution protocol: briefly centrifuge before opening, reconstitute in deionized sterile water to 0.1-1.0 mg/mL, and consider adding glycerol (5-50%) for stabilization .

  • Activity Loss:

    • Problem: Loss of functional activity after purification.

    • Solution: Verify proper folding, ensure appropriate buffer conditions, and consider adding stabilizing agents if necessary.

  • Antibody Specificity:

    • Problem: Cross-reactivity or low specificity of antibodies against RCOM_1491260.

    • Solution: Validate antibodies using positive and negative controls, consider using epitope-tagged versions of the protein, or develop new antibodies against unique epitopes.

How can researchers troubleshoot issues in Casparian strip visualization experiments involving RCOM_1491260?

When troubleshooting Casparian strip visualization experiments:

  • Poor Staining Results:

    • Problem: Weak or inconsistent staining of Casparian strips.

    • Solution: Optimize fixation conditions, adjust staining duration and concentration, ensure proper tissue penetration, and consider alternative stains (e.g., Basic Fuchsin for lignin).

  • Background Fluorescence:

    • Problem: High background making it difficult to distinguish specific signal.

    • Solution: Optimize washing steps, use appropriate blocking reagents, adjust imaging parameters, or consider spectral unmixing during image acquisition.

  • Developmental Timing:

    • Problem: Inconsistent Casparian strip development between samples.

    • Solution: Standardize plant growth conditions, carefully stage samples based on root length or other morphological markers, and analyze multiple positions along the root axis.

  • Localization Artifacts:

    • Problem: Protein mislocalization due to overexpression or fusion tags.

    • Solution: Use native promoters rather than constitutive promoters, test different tag positions, validate with antibody-based methods if available, or consider complementation of loss-of-function phenotypes as functional validation.

  • Microscopy Resolution:

    • Problem: Insufficient resolution to clearly visualize Casparian strip domain localization.

    • Solution: Employ super-resolution microscopy techniques, optimize optical sectioning, or use transmission electron microscopy for ultrastructural analysis.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.