Recombinant Ricinus communis CASP-like protein RCOM_1504680 (RCOM_1504680)

Shipped with Ice Packs
In Stock

Description

Role in Plant Physiology

  • CASP Family Function: CASP proteins scaffold membrane domains to direct lignin polymerization, forming Casparian strips in root endodermal cells. These strips act as apoplastic barriers to regulate ion homeostasis .

  • CASPL Subfamily: RCOM_1504680 is a CASP-like (CASPL) protein, a broader family with homologs in land plants and green algae. CASPLs share structural motifs with CASPs, including transmembrane domains critical for membrane localization .

Key Studies

  • Phylogenetic Analysis: CASPLs, including RCOM_1504680, are evolutionarily related to MARVEL domain proteins, which mediate membrane organization in eukaryotes .

  • Localization: CASPLs can integrate into CASP membrane domains when ectopically expressed, suggesting shared scaffolding properties .

  • Biochemical Interactions: CASPs recruit peroxidases to deposit lignin at Casparian strips. While RCOM_1504680’s interactome is uncharacterized, its structural similarity implies analogous functions .

Experimental Data

  • Expression Systems: Successfully produced in E. coli with high purity (>90%) .

  • Stability: Stable in lyophilized form but sensitive to repeated freeze-thaw cycles .

Expression and Purification

  • Vector: pMDC83 (Gateway cloning system) .

  • Reconstitution: Solubilize in sterile water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

ParameterSpecification
FormLyophilized powder
BufferTris/PBS, pH 8.0
ReconstitutionAdd glycerol to prevent aggregation
Shelf Life12 months (lyophilized), 6 months (liquid)

Limitations and Future Directions

  • Functional Gaps: No direct evidence links RCOM_1504680 to Casparian strip formation or stress responses.

  • Research Opportunities:

    • Characterize its interaction with peroxidases or transporters.

    • Investigate roles in abiotic stress using transgenic plants.

Product Specs

Form
Lyophilized powder
Please note that we prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will do our best to accommodate your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery details.
All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance as additional charges will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. To optimize long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution for storage at -20°C/-80°C. The default final glycerol concentration we use is 50%. You can use this value as a reference point.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store the product at -20°C/-80°C. Aliquoting is recommended for multiple uses. To maintain protein integrity, avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
RCOM_1504680; CASP-like protein 1F1; RcCASPL1F1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-179
Protein Length
full length protein
Species
Ricinus communis (Castor bean)
Target Names
RCOM_1504680
Target Protein Sequence
MENVEDKYNSPLKSQKLFIGAQICLRIVTIGATLAATWIMVTDKQSITFGDFVMVAKYNY SSAFKFFVLANVIACACSVVSLLFLCALGRYSSNPGHVFLLFLHDLLMMSLVLAGCSAAT AIGFLGKYGNTKSGWMPICDQFGQFCNRGTISMMLSYLSMVCLLILTVTSANKSRQIHV
Uniprot No.

Target Background

Database Links

KEGG: rcu:8275516

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems are typically used for RCOM_1504680 production?

Research facilities have successfully expressed RCOM_1504680 using two primary expression systems:

Expression SystemTag TypeApplication NotesSource
E. coliHis-tag (N-terminal)Suitable for basic structural and biochemical studies
BaculovirusVariable (determined during production)Preferred for studies requiring eukaryotic post-translational modifications

The choice between these systems depends on research requirements, with E. coli offering higher yield and simplicity, while baculovirus provides a eukaryotic environment that may better preserve native protein conformation and modifications .

What are the recommended storage and handling conditions for RCOM_1504680?

For optimal experimental outcomes, RCOM_1504680 should be stored according to the following guidelines:

  • Long-term storage: Store at -20°C/-80°C for extended stability

  • Lyophilized form: Maintains stability for up to 12 months at -20°C/-80°C

  • Liquid form: Has approximately 6 months shelf life at -20°C/-80°C

  • Working aliquots: Store at 4°C for up to one week

Researchers should avoid repeated freeze-thaw cycles as they can compromise protein integrity and activity. The recommended approach is to reconstitute the protein and prepare small working aliquots for immediate use, with the remainder stored at -80°C for maximum stability .

What protocol should be followed for reconstituting lyophilized RCOM_1504680?

The following methodological approach is recommended:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage, add glycerol to a final concentration of 5-50% (with 50% being the default recommendation)

  • Aliquot the reconstituted protein to minimize freeze-thaw cycles

  • Store aliquots at -20°C/-80°C for extended stability

Buffer composition plays a critical role in maintaining protein stability. RCOM_1504680 is typically supplied in either:

  • Tris/PBS-based buffer with 6% Trehalose, pH 8.0 , or

  • Tris-based buffer with 50% glycerol, optimized specifically for this protein

How can researchers analyze the structural characteristics of RCOM_1504680?

While the search results do not provide detailed structural information for RCOM_1504680, researchers can employ multiple methodological approaches:

  • Secondary structure prediction using computational tools based on the amino acid sequence

  • Circular dichroism (CD) spectroscopy to determine secondary structure elements

  • Size exclusion chromatography with multi-angle light scattering (SEC-MALS) to analyze oligomeric state

  • X-ray crystallography or cryo-electron microscopy for high-resolution structural determination

  • NMR spectroscopy for solution-state structural analysis and dynamics studies

The amino acid sequence suggests membrane-spanning domains, indicating RCOM_1504680 may be a membrane-associated protein . Hydrophobic regions within the sequence (e.g., "LAATWIMVTD" and other segments) further support this hypothesis and provide targets for structure-function studies.

What biochemical assays are appropriate for investigating RCOM_1504680 function?

Although specific functional information about RCOM_1504680 is limited in the search results, researchers can employ several methodological approaches based on its classification as a CASP-like protein:

  • Protein-protein interaction assays:

    • Pull-down assays using His-tagged RCOM_1504680

    • Co-immunoprecipitation with potential interaction partners

    • Yeast two-hybrid screening to identify novel binding partners

  • Cellular localization studies:

    • Immunofluorescence microscopy with antibodies against RCOM_1504680

    • Subcellular fractionation followed by Western blotting

    • Expression of fluorescently-tagged fusion proteins

  • Functional assays:

    • Analysis of membrane transport capabilities

    • Assessment of potential roles in signal transduction

    • Evaluation of protein stability and turnover rates

How can contradiction pattern analysis be applied to RCOM_1504680 experimental data?

When working with complex datasets from RCOM_1504680 experiments, researchers can apply contradiction pattern analysis to ensure data quality and identify inconsistencies. This approach is particularly valuable for multidimensional data where interdependencies exist between variables.

Following the notation proposed by Stausberg et al., contradictions can be represented using three parameters (α, β, θ) :

  • α represents the number of interdependent items

  • β represents the number of contradictory dependencies defined by domain experts

  • θ represents the minimal number of required Boolean rules to assess these contradictions

For example, when analyzing RCOM_1504680 functional assays, researchers might examine relationships between:

  • Protein concentration and activity measurements

  • Buffer composition and protein stability

  • Temperature conditions and aggregation state

Implementing this structured approach allows researchers to:

  • Systematically identify impossible or inconsistent data combinations

  • Improve data quality through automated contradiction detection

  • Develop more robust experimental designs that account for interdependencies

  • Apply Boolean minimization techniques to efficiently detect contradictions in large datasets

What considerations should be made when designing experiments to investigate RCOM_1504680 interactions?

When investigating potential interaction partners of RCOM_1504680, researchers should implement a methodological approach that addresses the following:

  • Control selection:

    • Positive controls: Known protein-protein interactions within the CASP-like protein family

    • Negative controls: Proteins unlikely to interact based on cellular localization or function

    • Technical controls: His-tag only or empty vector controls to identify false positives

  • Validation through multiple methods:

    • Primary screening via yeast two-hybrid or pull-down assays

    • Confirmation using orthogonal methods (co-IP, FRET, BiFC)

    • Functional validation of identified interactions

  • Experimental conditions:

    • Buffer optimization to maintain membrane protein solubility and native conformation

    • Consideration of detergent type and concentration if working with membrane-associated proteins

    • Temperature and pH conditions that preserve physiologically relevant interactions

  • Data analysis:

    • Statistical methods to distinguish specific from non-specific interactions

    • Network analysis to map RCOM_1504680 within protein interaction networks

    • Assessment of binding affinities and kinetics for key interactions

What methods should be used to verify the purity and integrity of recombinant RCOM_1504680?

To ensure experimental reproducibility and validity, researchers should verify protein quality using multiple complementary approaches:

Quality ParameterAssessment MethodAcceptance CriteriaNotes
PuritySDS-PAGE>85% (Baculovirus) or >90% (E. coli)Primary method mentioned in product specifications
IdentityMass spectrometryMatch to theoretical massConfirms correct primary sequence
HomogeneitySize exclusion chromatographySingle peak (monodisperse)Detects aggregation or degradation
IntegrityWestern blotSingle band at expected MWConfirms presence of full-length protein
ActivityFunction-specific assaysApplication dependentDepends on known protein function

What are common challenges when working with RCOM_1504680 and their solutions?

While specific challenges for RCOM_1504680 are not detailed in the search results, researchers working with membrane-associated proteins like RCOM_1504680 typically encounter:

  • Protein aggregation:

    • Solution: Optimize buffer composition with appropriate detergents or stabilizers

    • Methodology: Screen multiple buffer conditions using dynamic light scattering to identify conditions minimizing aggregation

  • Low expression yield:

    • Solution: Optimize codon usage for expression system or try alternative expression hosts

    • Methodology: Compare yields between E. coli and baculovirus systems, considering tags that enhance solubility

  • Improper folding:

    • Solution: Express in eukaryotic systems (baculovirus) that provide appropriate folding machinery

    • Methodology: Assess secondary structure using circular dichroism to confirm proper folding

  • Limited stability:

    • Solution: Add stabilizing agents (glycerol, trehalose) and store in single-use aliquots

    • Methodology: Monitor stability using thermal shift assays to identify optimal stabilizing conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.