Recombinant Ricinus communis Casparian strip membrane protein RCOM_1259250 (RCOM_1259250)

Shipped with Ice Packs
In Stock

Description

Recombinant Production and Purification

The protein is typically expressed in E. coli with an N-terminal His-tag for affinity chromatography purification . Key production parameters include:

ParameterSpecification
Expression SystemE. coli BL21(DE3) or similar strains
Purity>90% (SDS-PAGE verified)
Storage BufferTris/PBS-based, 6% Trehalose, pH 8.0
StabilityStable at -80°C for 1 year; avoid freeze-thaw cycles
Reconstitution0.1–1.0 mg/mL in sterile water + 50% glycerol

Source:

Research Applications

  • Plant Physiology Studies: Used to investigate Casparian strip formation and its role in root endodermal barrier function .

  • Pathogen Interaction Models: Identified in transcriptomic studies of black raspberry (Rubus occidentalis) under biotic stress, suggesting potential involvement in pathogen resistance .

  • Protein-Protein Interaction Assays: Serves as a target for identifying binding partners in membrane complexes .

Key Research Findings

  • Expression Analysis: RNA-seq data from Ricinus communis infected with Verticillium spp. showed differential regulation of RCOM_1259250, implying responsiveness to fungal pathogens .

  • Structural Predictions: AlphaFold modeling predicts four transmembrane domains, consistent with its role as a membrane anchor protein .

Limitations and Future Directions

Current research gaps include:

  • Functional Validation: No knockout or overexpression studies confirming its role in Casparian strip development.

  • Interaction Networks: Limited data on binding partners or pathway associations .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments include standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
RCOM_1259250; Casparian strip membrane protein 1; RcCASP1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Ricinus communis (Castor bean)
Target Names
RCOM_1259250
Target Protein Sequence
MSTTIEIPAESSAVAKGKAPLIGASSSSYEKKGGYKKGIAIFDFILRLGAVISALSAAAT MGTSDETLPFFTQFFQFEAGYDDFPTFQFFVIAMGFVGGYLVLSLPFSVVAIIRPHAVGI RLLLLILDTVALTLNTAAAAAAAAIVYLAHNGNQSANWLAVCQQFGDFCQKVSGGVVASF VSVLVFLLLVVMSAVALRKH
Uniprot No.

Target Background

Function
This protein regulates membrane-cell wall junctions and localized cell wall deposition. It is crucial for establishing the Casparian strip membrane domain (CSD) and subsequent formation of Casparian strips, a cell wall modification within the root endodermis. This modification creates an apoplastic barrier between the internal apoplasm and the external apoplasm, preventing lateral diffusion.
Database Links

KEGG: rcu:8269726

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

How is recombinant RCOM_1259250 produced and what are the optimal storage conditions?

Recombinant RCOM_1259250 is produced in E. coli expression systems, resulting in a His-tagged protein with greater than 90% purity as determined by SDS-PAGE . The protein is supplied as a lyophilized powder in Tris/PBS-based buffer .

For optimal handling:

  • Store the lyophilized protein at -20°C to -80°C upon receipt

  • Aliquot upon reconstitution to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freezing and thawing as this can compromise protein integrity

Storage ConditionRecommendationPurpose
Long-term storage-20°C to -80°CMaintain protein stability
Working solution4°C (up to one week)Immediate experimental use
FormLyophilized powderEnsures stability before reconstitution
BufferTris/PBS-basedMaintains pH and ionic environment

What are the predicted functional domains of RCOM_1259250?

Based on analysis of the amino acid sequence, RCOM_1259250 likely contains multiple transmembrane domains, consistent with its function as a Casparian strip membrane protein . While specific domains have not been explicitly characterized in the available literature, the protein sequence analysis suggests:

  • N-terminal signal peptide (first 20-25 amino acids)

  • Multiple hydrophobic regions that likely form transmembrane domains

  • Potential protein-protein interaction motifs

  • Possible phosphorylation sites that may regulate protein function

To identify functional domains experimentally, researchers should consider:

  • Bioinformatic analysis using tools that predict transmembrane regions, post-translational modification sites, and conserved domains

  • Deletion analysis to determine regions essential for proper localization and function

  • Comparative analysis with other Casparian strip proteins to identify conserved regions

What are appropriate experimental designs for studying RCOM_1259250 function in plants?

When designing experiments to investigate RCOM_1259250 function, researchers should consider various experimental designs based on their specific research questions:

  • True Experimental Designs:

    • Pretest-Posttest Control Group Design: Compare plants with normal versus modified RCOM_1259250 expression before and after a treatment

    • Solomon Four-Group Design: Include additional control groups without pretesting to account for potential testing effects

    • Posttest-Only Control Group Design: Appropriate when the pretest itself might influence the variables of interest

  • Quasi-Experimental Designs:

    • Time-Series Experiment: Monitor changes in plant phenotypes over time after modifying RCOM_1259250 expression or applying stress treatments

    • Multiple Time-Series Design: Compare temporal changes between experimental and control groups

    • Nonequivalent Control Group Design: Compare different plant varieties with varying levels of RCOM_1259250 expression

Design TypeApplication for RCOM_1259250 ResearchAdvantagesLimitations
Pretest-Posttest ControlStudying effects of environmental stress on RCOM_1259250 functionControls for initial differencesTime-consuming
Time-SeriesTracking developmental changes in RCOM_1259250 expressionReveals temporal dynamicsRequires multiple sampling
Nonequivalent Control GroupComparing RCOM_1259250 function in different plant genotypesUtilizes natural variationPotential confounding variables

How should researchers formulate appropriate research questions for studying RCOM_1259250?

Developing well-crafted research questions is crucial for meaningful investigations of RCOM_1259250. According to the "FINERMAPS" criteria, effective research questions should be :

  • Feasible: Can be answered with available resources and techniques

  • Interesting: Addresses knowledge gaps about RCOM_1259250

  • Novel: Explores unknown aspects of the protein

  • Ethical: Can be conducted within ethical guidelines

  • Relevant: Relates to current understanding of Casparian strip proteins

  • Manageable: Completable within a reasonable timeframe

  • Appropriate: Logically and scientifically sound

  • Potential value: Advances the field

  • Publishable: Of interest to the scientific community

  • Systematic: Amenable to methodical investigation

Examples of well-formulated research questions for RCOM_1259250:

  • "How does phosphorylation of key residues affect the membrane localization and function of RCOM_1259250 during salt stress?"

  • "What is the temporal and spatial expression pattern of RCOM_1259250 during root development, and how does it correlate with Casparian strip formation?"

  • "To what extent does RCOM_1259250 contribute to water use efficiency in Ricinus communis under drought conditions?"

What controls should be included when investigating RCOM_1259250 expression patterns?

Proper controls are essential for reliable interpretation of RCOM_1259250 expression analysis:

  • Negative controls:

    • No-template controls in PCR/qPCR reactions

    • Secondary antibody-only controls in immunolocalization

    • Empty vector controls in recombinant expression studies

    • Wild-type plants in transgenic studies

  • Positive controls:

    • Known Casparian strip proteins with established expression patterns

    • Constitutively expressed genes for normalization in qPCR

    • Proteins with known subcellular localization in localization studies

  • Experimental controls:

    • Multiple biological replicates (minimum 3)

    • Technical replicates for each measurement

    • Time-course samples to account for temporal variation

    • Multiple tissue types to determine tissue specificity

    • Environmental controls (light, temperature, humidity)

What techniques can be used to investigate protein-protein interactions involving RCOM_1259250?

Understanding the interaction partners of RCOM_1259250 can provide insights into its function and regulation. Several complementary techniques should be employed:

  • Co-immunoprecipitation (Co-IP): Using antibodies against the His-tag of recombinant RCOM_1259250 to pull down protein complexes from plant extracts

  • Pull-down assays: Using purified recombinant RCOM_1259250 as bait to capture interacting proteins from plant extracts

  • Yeast two-hybrid (Y2H) screening: Particularly using split-ubiquitin or membrane-based Y2H systems adapted for membrane proteins

  • Bimolecular Fluorescence Complementation (BiFC): To visualize interactions in living plant cells

  • Förster Resonance Energy Transfer (FRET): To detect protein proximity in vivo

  • Proximity-dependent biotin identification (BioID): To identify proteins in close proximity to RCOM_1259250 in living cells

  • Cross-linking mass spectrometry: To capture transient interactions and determine interaction interfaces

Each method has distinct advantages and limitations, particularly for membrane proteins like RCOM_1259250. To establish confidence in identified interactions, researchers should validate findings using at least two independent methods.

How can CRISPR-Cas genome editing be applied to study RCOM_1259250 function?

CRISPR-Cas technology offers powerful approaches to investigate RCOM_1259250 function through targeted genome modification:

  • Guide RNA design considerations:

    • Use CALITAS or similar CRISPR-Cas-aware alignment tools to identify optimal target sites and assess potential off-target effects

    • Design multiple guide RNAs targeting different regions of the RCOM_1259250 gene

    • Include PAM sequence compatibility checks for the Cas variant being used

  • Functional studies using CRISPR-Cas:

    • Gene knockout: Complete disruption of RCOM_1259250 expression

    • Promoter modification: Altering expression levels without affecting protein sequence

    • Base editing: Introducing specific amino acid substitutions

    • Tagging: Adding reporter genes or epitope tags for localization and interaction studies

  • Validation approaches:

    • Sequencing to confirm desired edits

    • Expression analysis to verify changes in RCOM_1259250 mRNA and protein levels

    • Phenotypic analysis focusing on root development and water use efficiency

    • Complementation studies to confirm phenotypes are due to RCOM_1259250 modification

CRISPR ApplicationPurpose in RCOM_1259250 ResearchKey Considerations
KnockoutDetermine loss-of-function phenotypesMay be lethal; consider conditional approaches
Base editingStudy specific amino acid functionsRequires precise design and validation
Promoter editingAlter expression levelsMaintain native regulation mechanisms
TaggingTrack protein localizationEnsure tag doesn't interfere with function

What techniques can assess the role of RCOM_1259250 in water use efficiency?

Given that Casparian strip proteins influence water transport in roots, investigating RCOM_1259250's role in water use efficiency (WUE) is scientifically relevant:

  • Physiological measurements:

    • Gas exchange parameters using infrared gas analyzers

    • Hydraulic conductivity of roots using pressure chamber techniques

    • Transpiration rates under controlled conditions

    • ^13^C discrimination analysis to estimate integrated WUE

  • Imaging techniques:

    • Fluorescent apoplastic tracers to assess Casparian strip integrity

    • Micro-computed tomography to visualize root architecture

    • Neutron radiography to track water movement in roots

  • Molecular approaches:

    • Compare wild-type plants with those having modified RCOM_1259250 expression

    • Assess gene expression changes in response to water deficit

    • Analyze protein levels and post-translational modifications under drought stress

  • Experimental design considerations:

    • Include appropriate controls and multiple biological replicates

    • Ensure standardized growth conditions

    • Test under both well-watered and water-deficit conditions

    • Consider temporal dynamics of responses

Research by Lupinus luteus suggests that rhizospheric calcium influences water use efficiency in plants , which could inform experimental designs investigating RCOM_1259250's potential role in calcium-dependent water transport regulation.

What statistical approaches are appropriate for analyzing data from RCOM_1259250 experiments?

The choice of statistical analysis depends on the experimental design and the nature of the data collected:

  • For comparing expression levels between groups:

    • t-tests (for two groups)

    • ANOVA with post-hoc tests (for multiple groups)

    • Non-parametric alternatives if data don't meet normality assumptions

  • For time-series data:

    • Repeated measures ANOVA

    • Mixed-effects models to account for random and fixed effects

    • Time-series analysis methods for temporal patterns

  • For correlation studies:

    • Pearson's or Spearman's correlation coefficients

    • Regression analysis to model relationships

    • Path analysis for complex relationships between multiple variables

  • For complex experimental designs:

    • Factorial ANOVA to assess multiple factors and their interactions

    • Nested designs when observations are grouped within higher-level units

    • Analysis of covariance (ANCOVA) to control for continuous variables

When analyzing data, researchers should:

  • Clearly state hypotheses before data collection

  • Ensure appropriate sample sizes through power analysis

  • Check assumptions of statistical tests

  • Report effect sizes along with p-values

  • Consider multiple testing corrections when performing numerous tests

How can researchers address contradictory data when studying RCOM_1259250 function?

When faced with contradictory results regarding RCOM_1259250 function, researchers should implement a systematic approach:

  • Methodological evaluation:

    • Compare experimental protocols in detail

    • Identify differences in materials, methods, or controls

    • Assess reagent quality and specificity (especially antibodies)

    • Evaluate the sensitivity and resolution of detection methods

  • Biological context considerations:

    • Determine if contradictions relate to different developmental stages

    • Compare plant growth conditions and treatments

    • Assess genetic background differences between plant lines

    • Consider post-translational modifications or protein isoforms

  • Validation strategies:

    • Replicate experiments using multiple methodologies

    • Perform dose-response or time-course studies

    • Use genetic approaches (mutants, overexpression) to confirm function

    • Collaborate with other laboratories to independently validate findings

  • Integrated data analysis:

    • Combine data from multiple approaches

    • Consider meta-analysis techniques

    • Develop models that might explain apparent contradictions

How can researchers distinguish direct versus indirect effects of RCOM_1259250 on plant phenotypes?

Distinguishing direct from indirect effects is crucial for understanding RCOM_1259250's true function:

  • Temporal analysis:

    • Establish the sequence of molecular and physiological changes

    • Early responses are more likely to be direct effects

    • Use time-course experiments with fine temporal resolution

  • Spatial analysis:

    • Determine where RCOM_1259250 is expressed and localized

    • Compare with the spatial pattern of observed phenotypes

    • Effects in tissues lacking RCOM_1259250 are likely indirect

  • Molecular approaches:

    • Identify direct binding partners through interaction studies

    • Use inducible expression systems to observe immediate effects

    • Perform ChIP-seq or RNA-seq to identify direct molecular targets

  • Genetic approaches:

    • Create tissue-specific or inducible knockouts/overexpression

    • Perform epistasis analysis with related genes

    • Use complementation with mutated versions to identify critical domains

  • Biochemical validation:

    • Reconstitute activities in vitro with purified components

    • Demonstrate direct biochemical activities of RCOM_1259250

    • Perform enzyme assays if enzymatic activity is suspected

How can RCOM_1259250 research contribute to understanding plant adaptation to environmental stresses?

Research on RCOM_1259250 can provide valuable insights into plant stress responses:

  • Drought stress responses:

    • Investigate RCOM_1259250's role in regulating water transport

    • Examine how RCOM_1259250 expression and localization change during water deficit

    • Assess whether RCOM_1259250 modifications can improve drought tolerance

  • Nutrient uptake regulation:

    • Study how RCOM_1259250 affects the selectivity of the Casparian strip barrier

    • Investigate interactions between RCOM_1259250 and nutrient transporters

    • Determine if RCOM_1259250 expression responds to nutrient availability

  • Salt stress adaptation:

    • Examine RCOM_1259250's role in preventing sodium uptake into the vasculature

    • Assess post-translational modifications under salt stress

    • Compare RCOM_1259250 function in salt-sensitive versus salt-tolerant plants

  • Climate change applications:

    • Investigate RCOM_1259250's function under elevated CO₂ conditions

    • Examine responses to combined stresses (drought + heat)

    • Assess potential for genetic modifications to improve resilience

What are the key considerations for experimental reproducibility in RCOM_1259250 research?

Ensuring reproducibility in RCOM_1259250 research requires attention to several factors:

  • Materials standardization:

    • Document protein source, production method, and quality control measures

    • Specify plant genotypes, growth conditions, and developmental stages

    • Validate antibody specificity and batch consistency

  • Methods documentation:

    • Provide detailed protocols with all parameters specified

    • Report instrument settings and calibration procedures

    • Include all controls and validation approaches

  • Data management:

    • Establish clear data collection and analysis workflows

    • Document software versions and statistical approaches

    • Maintain raw data and analysis scripts

  • Reporting practices:

    • Follow field-specific reporting guidelines

    • Include negative and inconclusive results

    • Provide detailed methods sections in publications

    • Share materials, data, and code through repositories

  • Validation approaches:

    • Use multiple techniques to confirm key findings

    • Include biological and technical replicates

    • Consider independent validation by collaborators

How can comparative analysis across species enhance understanding of RCOM_1259250 function?

Comparative approaches can provide evolutionary context and functional insights:

  • Phylogenetic analysis:

    • Identify RCOM_1259250 homologs across plant species

    • Determine conservation patterns and divergence points

    • Correlate protein features with environmental adaptations

  • Structure-function relationships:

    • Compare conserved domains and variable regions

    • Identify critical amino acid residues through multiple sequence alignment

    • Relate structural differences to functional divergence

  • Expression pattern comparison:

    • Compare tissue-specific and developmental expression across species

    • Examine stress-responsive expression in different ecological niches

    • Identify conserved and divergent regulatory elements

  • Functional complementation:

    • Express RCOM_1259250 homologs from different species in model plants

    • Test ability to rescue mutant phenotypes

    • Identify species-specific functional differences

This cross-species perspective can reveal fundamental aspects of RCOM_1259250 function while highlighting adaptations that may be relevant for agricultural applications or understanding plant evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.