Recombinant Ricinus communis Casparian strip membrane protein RCOM_1259260 (RCOM_1259260)

Shipped with Ice Packs
In Stock

Description

Functional Role in Plants

RCOM_1259260 is a homolog of Arabidopsis CASP proteins, which are essential for:

  • Casparian Strip Formation: Localizing lignin-polymerizing enzymes (e.g., peroxidases) to create apoplastic barriers in endodermal cells .

  • Membrane Scaffolding: Restricting diffusion of plasma membrane proteins and lipids via transmembrane domain interactions .

  • Evolutionary Conservation: CASPL proteins (including RCOM_1259260) share structural motifs with MARVEL family proteins, suggesting ancient roles in membrane organization .

3.1. Drug Development

  • Used in studying protein-protein interactions (e.g., peroxidases) for targeted therapies .

  • Example: Bispecific Nanofitins engineered for tumor selectivity rely on similar recombinant protein scaffolds .

3.3. Agricultural Biotechnology

  • Investigating Casparian strip integrity in crops for enhanced nutrient uptake and stress resistance .

Case Studies Involving CASP-like Proteins

StudyFindingsRelevance to RCOM_1259260
EGFR/PDL1 Nanofitins Bispecific proteins improved tumor targeting by dual antigen engagement.Supports scaffold-based therapeutic design.
DNM2-NME1 Interaction Dynamin-dependent endocytosis regulated metastasis suppression.Highlights CASP-like roles in signaling.
FGF4 Regulation miR-511 suppressed breast cancer via FGF4 targeting.Demonstrates protein-kinase interplay.

Technical Considerations

  • Stability: Avoid repeated freeze-thaw cycles; aliquot for long-term storage .

  • Activity Validation: Pair with lignin deposition assays or co-immunoprecipitation (Co-IP) for functional studies .

Future Directions

  • CASP Scaffold Engineering: Leveraging AlphaFold models to design synthetic membrane domains .

  • Cross-Species Comparisons: Evolutionary analysis of CASPLs in non-angiosperms to uncover ancestral functions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All protein shipments include standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RCOM_1259260; Casparian strip membrane protein 2; RcCASP2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Ricinus communis (Castor bean)
Target Names
RCOM_1259260
Target Protein Sequence
MMKSDSVAIDVPESSSVAKRKAPFMANIRDENGGYKKGLAIFDFILRLGAIAAALGAAST MGTSDETLPFFTQFFQFNAGYDDFPTFQFFVIAMAMVAGYLVLSLPFSIVSICRPHAAGP RILLFILDTVALTLNAAAGAAAADIVYLAHNGNQTTNWLAICLQFGDFCREVSGSVVASF ASVVILMVLVVMSGLALRRY
Uniprot No.

Target Background

Function

Recombinant Ricinus communis Casparian strip membrane protein RCOM_1259260 (RCOM_1259260) regulates membrane-cell wall junctions and localized cell wall deposition. It is essential for establishing the Casparian strip membrane domain (CSD) and subsequent Casparian strip formation. Casparian strips are cell wall modifications in the root endodermis that create an apoplastic barrier between the intraorganismal and extraorganismal apoplasm, preventing lateral diffusion.

Database Links

KEGG: rcu:8269727

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

Structural and Functional Characterization

Q: What are the key functional domains of Recombinant Ricinus communis Casparian strip membrane protein RCOM_1259260?

A: RCOM_1259260, like other Casparian strip membrane domain proteins (CASPs), likely contains four transmembrane domains with conserved residues that are critical for its localization and function. The protein forms a membrane domain similar to the Casparian strip membrane domain (CSD) observed in model plants. When characterizing these domains, researchers should focus on the conserved residues in the transmembrane regions, as mutations in these areas have been shown to affect localization patterns in related proteins . Methodologically, a combination of computational prediction tools for transmembrane domains and experimental approaches including site-directed mutagenesis should be employed to identify and characterize these domains.

Q: How do I determine if RCOM_1259260 forms membrane domains similar to those observed in Arabidopsis CASPs?

A: To determine domain formation capabilities, employ fluorescent protein tagging (typically mCherry or GFP) and observe localization patterns in heterologous expression systems or native tissues. As observed with related proteins, RCOM_1259260 would likely initially target the whole plasma membrane before being removed from lateral membranes and localizing exclusively to specialized domains . Time-course imaging is essential, as CASPs show characteristic temporal patterns of localization. Comparative studies with known CASP proteins (such as AtCASP1) can serve as positive controls. The experimental design should include:

Time PointExpected ObservationControl Measurement
Initial (0-2h)Whole plasma membrane localizationMembrane marker distribution
Intermediate (2-6h)Reduction in lateral membrane signalQuantification of signal intensity
Late (6-24h)Exclusive domain localizationDomain size and stability measurement

Expression and Localization Studies

Q: What techniques are most effective for studying the expression pattern of RCOM_1259260 in Ricinus communis tissues?

A: The most effective approach combines multiple complementary techniques. For transcript-level analysis, quantitative RT-PCR provides tissue-specific expression patterns, while RNA-Seq offers genome-wide context. For protein-level analysis, immunohistochemistry with specific antibodies or expression of fluorescently-tagged fusion proteins provides spatial information. When designing these experiments, follow a randomized group design with appropriate controls . The experimental approach should include:

  • Tissue collection from different plant organs (roots, stems, leaves, etc.)

  • RNA extraction and quality control (RIN >8)

  • Primer design specific to RCOM_1259260, avoiding cross-reactivity with related CASPLs

  • Normalization against at least three reference genes for qRT-PCR

  • Statistical analysis using appropriate methods (ANOVA followed by post-hoc tests)

Q: How can I differentiate between RCOM_1259260 and other CASP-like proteins when studying localization patterns?

A: Differentiation requires a multi-faceted approach. First, develop highly specific antibodies targeting unique epitopes of RCOM_1259260 not present in other CASP-like proteins. Alternatively, use epitope-tagged versions of the protein for expression studies. Second, employ CRISPR-Cas9 knockout or knockdown approaches to create loss-of-function mutants, followed by complementation with the wild-type or mutated versions of RCOM_1259260. When analyzing localization data, employ image analysis software to quantify colocalization with known membrane markers. This approach helps distinguish authentic localization from artifacts and provides statistical robustness to the observations .

Evolutionary Analysis

Q: How can I conduct a meaningful evolutionary analysis of RCOM_1259260 in relation to other plant CASP proteins?

A: A comprehensive evolutionary analysis should include multiple approaches. Begin with sequence alignment of RCOM_1259260 with other CASPs and CASP-like (CASPL) proteins from diverse plant species. Use both whole-protein alignments and focused alignments of conserved domains. Construct phylogenetic trees using maximum likelihood or Bayesian methods, testing multiple evolutionary models to find the best fit. When examining conservation patterns, pay particular attention to the transmembrane domains, as studies have shown conserved residues in these regions are critical for CASP localization . Additionally, analyze selection pressures (dN/dS ratios) across different protein regions to identify domains under purifying or positive selection. The evolutionary context provides crucial insights into structural constraints and functional importance of specific protein regions.

Protein-Protein Interactions

Q: What methodologies are most suitable for identifying protein interaction partners of RCOM_1259260?

A: To comprehensively identify interaction partners, employ multiple complementary approaches:

  • Yeast two-hybrid (Y2H) screening using RCOM_1259260 as bait against a Ricinus communis cDNA library

  • Co-immunoprecipitation (Co-IP) followed by mass spectrometry

  • Bimolecular fluorescence complementation (BiFC) for validating specific interactions

  • Proximity-dependent biotin identification (BioID) for detecting transient or weak interactions

Each method has strengths and limitations that must be considered in experimental design. For membrane proteins like RCOM_1259260, traditional Y2H may present challenges due to the hydrophobic transmembrane domains. Modified membrane Y2H systems or split-ubiquitin assays are preferred alternatives. When analyzing interaction data, apply appropriate statistical methods to distinguish specific interactions from background . Previous studies with related proteins suggest potential interactions with peroxidases involved in lignin deposition, which should be specifically examined .

Q: How do I determine if RCOM_1259260 interacts with cell wall modification enzymes similar to other CASP proteins?

A: Based on knowledge that CASPs interact with secreted peroxidases to mediate lignin deposition and cell wall modifications , design targeted experiments to test these specific interactions. Begin with in vitro binding assays using purified recombinant RCOM_1259260 and candidate peroxidases from Ricinus communis. Follow with co-localization studies in planta to determine if these proteins occupy the same subcellular compartments. For functional validation, use enzyme activity assays in the presence and absence of RCOM_1259260 to assess if the protein modulates enzymatic activity. The experimental design should follow a pre-post randomized group approach to allow for both within-group and between-group comparisons . Document the kinetics of interactions using appropriate binding models and determine binding constants to quantify interaction strength.

Mutational Analysis

Q: What mutational approaches would be most informative for understanding RCOM_1259260 function?

A: A comprehensive mutational analysis should focus on several key aspects:

Mutation TypeTarget ResiduesExpected OutcomeAnalysis Method
Conserved transmembrane residuesBased on alignment with AtCASP1 (e.g., G158, W164, C168)Altered localization patternsFluorescence microscopy
CASP subgroup-specific residuesUnique to RCOM_1259260Potential species-specific functionsFunctional complementation
Domain deletionsVarious transmembrane domainsDisrupted membrane domain formationMembrane fractionation
Phosphorylation sitesPredicted by bioinformatics toolsAltered protein dynamicsPhospho-mimetic mutations

Design your experiments following a Solomon Four Group design where possible, incorporating pre-testing, randomization, and appropriate controls . This design helps address multiple research questions simultaneously and controls for testing effects. For each mutation, analyze both localization patterns and functional outcomes, as studies have shown these two aspects can be uncoupled in CASP proteins .

Q: How can I design experiments to determine if mutations in RCOM_1259260 affect both membrane domain formation and cell wall modification?

A: This question addresses the dual functionality of CASP proteins observed in previous studies . Design a systematic approach that examines both aspects independently:

  • For membrane domain formation:

    • Create fluorescently tagged mutant versions of RCOM_1259260

    • Observe localization patterns using high-resolution confocal microscopy

    • Measure lateral diffusion rates using techniques like FRAP (Fluorescence Recovery After Photobleaching)

    • Quantify domain size, stability, and turnover rates

  • For cell wall modification:

    • Analyze lignin deposition patterns using histochemical stains

    • Measure peroxidase activity in the presence of wild-type vs. mutant RCOM_1259260

    • Quantify cell wall composition changes using FTIR or mass spectrometry

    • Assess functional outcomes through physiological assays

Use a pre-post randomized group design to compare outcomes before and after expression of mutant proteins . This approach allows for more robust causal inferences about the effects of specific mutations.

Comparative Studies

Q: How should I design experiments to compare RCOM_1259260 with other CASP proteins from different plant species?

  • Subcellular localization patterns and dynamics

  • Ability to form specialized membrane domains

  • Interactions with conserved partner proteins

  • Functional complementation of mutants

Employ a randomized group design with multiple biological and technical replicates . When analyzing data, use multivariate statistical approaches to identify patterns of functional conservation and divergence. This comparative approach provides insights into the evolutionary constraints on CASP protein function and helps identify lineage-specific adaptations.

Recombinant Protein Production

Q: What expression system is most suitable for producing functional recombinant RCOM_1259260 for biochemical studies?

A: The choice of expression system is critical for obtaining functional membrane proteins. Consider these options:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, low costMay misfold membrane proteinsSoluble domains, initial screening
Yeast (P. pastoris)Eukaryotic processing, high yieldDifferent membrane compositionFull-length protein, functional studies
Insect cellsComplex eukaryotic processingHigher cost, longer production timeStructural studies, interaction analyses
Plant expression systemsNative-like environmentLower yield, more complexIn vivo functional validation

For RCOM_1259260, a stepwise approach is recommended. Begin with E. coli expression of soluble domains for initial characterization and antibody production. For full-length protein, use P. pastoris or insect cell systems with appropriate solubilization and purification protocols. Verify protein folding and function through circular dichroism, limited proteolysis, and functional assays. The experimental design should follow a static group approach with appropriate controls for each expression system .

Q: What strategies can overcome challenges in purifying membrane proteins like RCOM_1259260?

A: Purification of membrane proteins presents specific challenges that require specialized approaches:

  • Solubilization optimization:

    • Test multiple detergents (DDM, LMNG, digitonin) at various concentrations

    • Consider novel solubilization methods like SMALPs (styrene maleic acid lipid particles)

    • Optimize buffer conditions (pH, salt concentration, additives)

  • Purification strategy:

    • Use affinity tags positioned to minimize interference with protein function

    • Consider two-step purification (affinity followed by size exclusion)

    • Implement on-column detergent exchange if needed

  • Quality control:

    • Assess monodispersity through size exclusion chromatography

    • Verify functional activity with appropriate assays

    • Analyze lipid co-purification through mass spectrometry

Design your experimental approach following a pre-post randomized group design to systematically compare different conditions . Document purification yields, purity, and functional activity for each condition tested.

Functional Assays

Q: What assays can demonstrate the membrane barrier function of RCOM_1259260?

A: To assess membrane barrier function similar to that observed in other CASPs , implement multiple complementary approaches:

  • Fluorescent lipid diffusion assays:

    • Express RCOM_1259260 in appropriate cell systems

    • Introduce fluorescent lipid analogs to one side of the membrane domain

    • Monitor diffusion using time-lapse microscopy

    • Quantify barrier function through fluorescence intensity measurements

  • Transporter distribution analysis:

    • Co-express RCOM_1259260 with fluorescently tagged membrane transporters

    • Observe polarized distribution of transporters

    • Quantify enrichment in specific membrane domains

  • Electrophysiological approaches:

    • Measure ion flow across membranes with and without RCOM_1259260 domains

    • Assess barrier function through changes in electrical resistance

Design these experiments using a random group approach with appropriate controls . The experimental groups should include wild-type RCOM_1259260, known mutants with altered function, and negative controls lacking the protein entirely.

Q: How can I quantitatively assess the role of RCOM_1259260 in cell wall modification?

A: Quantitative assessment of cell wall modification requires multiple analytical approaches:

  • Histochemical analysis:

    • Use lignin-specific stains (phloroglucinol-HCl, Basic Fuchsin)

    • Quantify staining intensity using image analysis software

    • Compare wild-type vs. RCOM_1259260 mutant tissues

  • Biochemical quantification:

    • Extract and quantify lignin content using acetyl bromide method

    • Analyze lignin composition through thioacidolysis or DFRC (derivatization followed by reductive cleavage)

    • Measure peroxidase activity in the presence of purified RCOM_1259260

  • Advanced analytical techniques:

    • Employ FTIR or Raman spectroscopy for non-destructive cell wall analysis

    • Use mass spectrometry to identify specific chemical modifications

    • Implement atomic force microscopy to assess nanomechanical properties

Design your experiments following a pre-post randomized group design to compare cell wall properties before and after expression of RCOM_1259260 or its mutant variants . This approach provides robust evidence for the causal role of the protein in cell wall modifications.

Data Analysis and Interpretation

Q: What statistical approaches are most appropriate for analyzing localization patterns of RCOM_1259260?

A: Quantitative analysis of protein localization requires specialized statistical approaches:

  • Descriptive statistics:

    • Calculate mean fluorescence intensity in different membrane domains

    • Determine coefficient of variation to assess homogeneity

    • Measure domain size, number, and distribution patterns

  • Comparative analyses:

    • Use ANOVA with appropriate post-hoc tests for multi-group comparisons

    • Apply mixed-effects models for time-series localization data

    • Implement Manders' or Pearson's coefficients for co-localization analysis

  • Advanced techniques:

    • Apply cluster analysis to identify distinct localization patterns

    • Use machine learning approaches for automated pattern recognition

    • Implement bootstrapping or permutation tests for robust inference

Q: How should I approach integrating multiple datasets (transcriptomic, proteomic, localization) to understand RCOM_1259260 function?

A: Integrative analysis requires systematic approaches to combine diverse data types:

  • Data preprocessing:

    • Normalize each dataset appropriately

    • Address missing values through imputation or exclusion

    • Transform data to comparable scales when necessary

  • Integration methods:

    • Use correlation networks to identify relationships between datasets

    • Apply dimension reduction techniques (PCA, t-SNE) for visualization

    • Implement Bayesian integration frameworks for probabilistic modeling

  • Functional interpretation:

    • Conduct enrichment analysis using Gene Ontology or pathway databases

    • Build predictive models linking molecular features to functional outcomes

    • Validate key findings through targeted experiments

Design your integrative analysis following systematic procedures with appropriate controls for batch effects and technical variations . When interpreting results, consider multiple competing hypotheses and evaluate evidence for each, rather than focusing solely on confirming a preferred hypothesis.

Common Conflicting Results

Q: How should I address contradictory findings on RCOM_1259260 localization patterns reported in different studies?

A: Contradictions in localization patterns may arise from multiple sources that require systematic investigation:

  • Methodological differences:

    • Compare imaging techniques (confocal vs. super-resolution microscopy)

    • Evaluate tag positions (N-terminal vs. C-terminal fusions)

    • Assess expression levels (native vs. overexpression)

  • Biological variables:

    • Analyze developmental stage differences

    • Consider environmental conditions during experiments

    • Examine genetic background variations

  • Resolution approach:

    • Design experiments that directly test competing hypotheses

    • Implement standardized protocols across laboratories

    • Conduct time-course studies to capture dynamic localization patterns

When evaluating conflicting findings, avoid simplistic acceptance or rejection of results . Instead, develop a nuanced understanding of conditions under which different patterns emerge. Design resolution experiments using a Solomon Four Group design when possible, incorporating pre-testing, randomization, and appropriate controls .

Q: What approaches help reconcile contradictory functional data on RCOM_1259260?

A: Reconciling functional contradictions requires systematic investigation of sources of variation:

  • Experimental context analysis:

    • Compare in vitro vs. in vivo functional assays

    • Evaluate heterologous vs. native expression systems

    • Assess acute vs. chronic manipulations of protein function

  • Technical validation:

    • Reproduce key experiments using standardized protocols

    • Employ multiple independent methods to measure the same function

    • Conduct dose-response or time-course studies to capture complexity

  • Theoretical integration:

    • Develop models that accommodate seemingly contradictory results

    • Identify boundary conditions that determine when different outcomes occur

    • Consider emergent properties that arise from system-level interactions

Design your reconciliation approach following a pre-post randomized group design with explicit consideration of variables that might mediate functional outcomes. This methodical approach transforms contradictions from obstacles into opportunities for deeper mechanistic understanding .

Methodological Reconciliation

Q: How can I design experiments to resolve contradictions between protein interaction studies of RCOM_1259260?

A: Contradictions in protein interaction data often arise from methodological differences that can be systematically addressed:

  • Method-specific artifacts:

    • Compare results from multiple interaction detection methods

    • Evaluate the impact of detergents on membrane protein interactions

    • Assess whether tags interfere with interaction interfaces

  • Validation experiments:

    • Design reciprocal co-immunoprecipitation with antibodies targeting different epitopes

    • Implement domain mapping to identify specific interaction regions

    • Use mutational analysis to disrupt predicted interaction surfaces

  • Contextual factors:

    • Test interactions under varying conditions (pH, salt concentration, redox state)

    • Evaluate the impact of post-translational modifications

    • Consider the role of accessory proteins in stabilizing interactions

When designing reconciliation experiments, implement a Solomon Four Group design with appropriate controls for each method. This approach helps distinguish true biological variation from methodological artifacts and provides a more complete understanding of the protein's interaction landscape .

Q: What strategies help address contradictory results in RCOM_1259260 mutational studies?

A: Mutational studies may yield contradictory results due to various factors that require systematic investigation:

  • Mutation design differences:

    • Compare substitution types (conservative vs. non-conservative)

    • Evaluate the impact of mutation position relative to functional domains

    • Assess potential structural disturbances using computational predictions

  • Expression system variations:

    • Test mutations in multiple cell types or organisms

    • Control expression levels through inducible systems

    • Consider the impact of endogenous proteins on mutant phenotypes

  • Phenotypic analysis approaches:

    • Implement multiple complementary assays for each mutant

    • Conduct dose-response studies where applicable

    • Evaluate acute vs. chronic effects of mutations

Design your reconciliation strategy following a random group approach with appropriate controls . When analyzing results, consider the possibility that contradictions reflect genuine biological complexity rather than experimental error. This perspective transforms contradictions into insights about context-dependent protein function .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.