Recombinant Ricinus communis Casparian strip membrane protein RCOM_1282030 (RCOM_1282030)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate specific format requirements. Please indicate your preferences in the order notes and we will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timelines, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by multiple factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us and we will prioritize development of the specified tag.
Synonyms
RCOM_1282030; Casparian strip membrane protein 3; RcCASP3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Ricinus communis (Castor bean)
Target Names
RCOM_1282030
Target Protein Sequence
MDSEKTGEAKITIQEPKAADPKGKGIADAPPPPVVVTTAKAIQKLPRGGWKKGVAIFDFV VRLCAIATGLAATGIMGTTEQTLPFFTQFFQFHAEYNDLPTFMFFVFANGIASGYLILSL PFSIVCIVRPLAIVPRLLLIIFDTVVMALTIAAASAAAAIVYLAHNGNSNANWNAICQQF NDFCQQTSTAVVASFITAAMLTFLIVLSAFALKRN
Uniprot No.

Target Background

Function
This protein plays a crucial role in regulating membrane-cell wall junctions and localized cell wall deposition. It is essential for establishing the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis. Casparian strips act as an apoplastic barrier between the internal apoplasm and the external apoplasm, preventing lateral diffusion.
Database Links

KEGG: rcu:8263304

Protein Families
Casparian strip membrane proteins (CASP) family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is RCOM_1282030 and what is its functional role in Ricinus communis?

RCOM_1282030 belongs to the Casparian strip membrane domain protein (CASP) family, which are four-transmembrane proteins that form specialized membrane domains in the plant endodermis. Like other CASPs, RCOM_1282030 likely contributes to two critical functions: (1) creating a membrane diffusion barrier that prevents lateral diffusion of membrane components, and (2) directing the modification of adjacent cell wall regions through interaction with secreted peroxidases to mediate lignin deposition and formation of Casparian strips . In Ricinus communis specifically, this protein would be essential for establishing the endodermal barrier that controls water and nutrient uptake into the vascular tissues.

The functional significance of RCOM_1282030 can be understood through examining its role in membrane domain formation:

FunctionCellular ProcessPhysiological Significance
Membrane domain establishmentFormation of Casparian strip membrane domain (CSD)Creates diffusion barrier between lateral membranes
Cell wall modificationInteraction with peroxidases for lignin depositionForms impermeable Casparian strip in cell wall
Water/nutrient regulationBarrier formation in endodermisControls selective absorption into vascular tissue

How does the structure of RCOM_1282030 relate to its function?

As a CASP family protein, RCOM_1282030 is characterized by four transmembrane domains that anchor it within the plasma membrane. The protein's structure is critical to its function in several ways:

The four-transmembrane topology allows RCOM_1282030 to establish stable membrane domains with extremely low turnover once localized to the Casparian strip membrane domain (CSD) . The protein initially targets to the entire plasma membrane but is quickly removed from lateral membranes to remain exclusively at the CSD . This localization pattern is essential for its barrier function.

Of particular importance is the extracellular loop 1 (EL1) region, which contains a CASP-specific signature that correlates with the ability to form Casparian strips. This signature is found in all plants that possess Casparian strips and is absent in plants lacking them . The conserved residues in the transmembrane domains are likely involved in protein-protein interactions that allow CASP proteins to form higher-order structures in the membrane.

How should I design experiments to study RCOM_1282030 localization in plant tissues?

When designing experiments to study RCOM_1282030 localization, consider the following methodological approach:

Step 1: Define your variables clearly

  • Independent variable: Expression of RCOM_1282030 (wild-type vs. modified versions)

  • Dependent variable: Protein localization patterns in endodermal cells

  • Control variables: Growth conditions, developmental stage, tissue type

Step 2: Generate fluorescent protein fusions
Create N- and C-terminal fusions of RCOM_1282030 with fluorescent proteins (e.g., GFP, mCherry). Given that CASPs localize to specific membrane domains, both N- and C-terminal fusions should be tested to ensure tag position doesn't disrupt localization .

Step 3: Transform Ricinus communis or heterologous system
Establish stable transgenic lines expressing the fusion proteins under native or constitutive promoters. For faster results, consider transient expression systems if available for Ricinus communis.

Step 4: Imaging methodology
Employ confocal microscopy with appropriate membrane markers to track protein localization throughout endodermal development. Use time-lapse imaging to capture the dynamic process of RCOM_1282030 relocalization from the entire plasma membrane to the CSD, as observed with other CASP proteins .

Step 5: Quantitative analysis
Measure fluorescence intensity along different membrane domains and analyze protein dynamics using fluorescence recovery after photobleaching (FRAP) to assess protein turnover rates at different membrane locations.

What expression systems are most effective for producing recombinant RCOM_1282030?

The choice of expression system for recombinant RCOM_1282030 production requires careful consideration of several factors. Based on knowledge about membrane proteins and full-length protein production challenges:

Prokaryotic Expression Systems:
E. coli-based expression systems may present challenges for RCOM_1282030 due to:

  • The hydrophobicity of transmembrane domains

  • Potential codon usage differences between Ricinus communis and E. coli

  • Lack of post-translational modifications

To overcome these limitations in prokaryotic systems:

  • Use specialized E. coli strains designed for membrane protein expression (e.g., C41/C43)

  • Optimize codons for E. coli expression

  • Consider fusion tags to enhance solubility (e.g., MBP, SUMO)

Eukaryotic Expression Systems:
For maintaining native conformation and post-translational modifications:

  • Insect cell systems (Sf9, High Five) offer a good compromise between yield and proper folding

  • Yeast systems (P. pastoris) can be effective for membrane protein expression

  • Plant-based expression systems may provide the most native environment but potentially lower yields

Expression Optimization Table:

SystemAdvantagesDisadvantagesOptimization Strategies
E. coliHigh yield, low costMay misfold, lacks PTMsFusion tags, specialized strains, reduced induction temperature
YeastEukaryotic PTMs, high densityMedium cost, potential hyperglycosylationMethanol-inducible promoters, optimization of growth parameters
Insect cellsGood folding, moderate PTMsHigher cost, longer timeOptimize MOI, harvest time, consider stable cell lines
Plant cellsNative environmentLower yields, longer developmentCodon optimization, organelle targeting signals

When expressing full-length RCOM_1282030, be vigilant about potential truncated products resulting from proteolysis or improper translation initiation . Using dual fusion tags (N- and C-terminal) can help identify and purify only full-length protein.

What purification strategies work best for transmembrane proteins like RCOM_1282030?

Purifying RCOM_1282030 presents challenges common to membrane proteins with multiple transmembrane domains. A systematic approach is necessary:

Step 1: Membrane extraction
Begin with gentle solubilization using appropriate detergents. For four-transmembrane proteins like RCOM_1282030, consider:

  • n-Dodecyl β-D-maltoside (DDM) - relatively mild and preserves protein function

  • Digitonin - particularly gentle for protein complexes

  • LMNG (Lauryl maltose neopentyl glycol) - high stability and low CMC

Test multiple detergents in small-scale experiments to identify optimal conditions that maintain RCOM_1282030 in its native conformation.

Step 2: Affinity purification
Utilize affinity tags strategically placed to avoid interference with protein folding:

  • His6 tags work well for IMAC purification but consider using increased imidazole concentration during elution to separate full-length protein from truncated versions

  • Strep-II tag or FLAG tag offer highly specific binding with mild elution conditions

  • Consider tandem affinity purification for higher purity

Step 3: Size exclusion chromatography
Perform size exclusion chromatography to:

  • Remove aggregates and ensure monodispersity

  • Analyze oligomeric state (CASP proteins may form higher-order assemblies)

  • Exchange into final stabilizing buffer

Step 4: Assessment of protein quality
Confirm protein integrity and functionality through:

  • SDS-PAGE to verify molecular weight and purity

  • Western blotting with anti-RCOM_1282030 antibodies

  • Mass spectrometry to confirm identity

  • Circular dichroism to assess secondary structure

How can I assess protein-protein interactions involving RCOM_1282030?

Understanding RCOM_1282030 interactions with other proteins is crucial for elucidating its function in Casparian strip formation. CASPs are known to interact with peroxidases and potentially other proteins to coordinate cell wall modification . Multiple complementary approaches should be employed:

In vitro approaches:

  • Pull-down assays: Use purified recombinant RCOM_1282030 as bait to identify interacting partners from plant extracts

  • Surface Plasmon Resonance (SPR): Measure binding kinetics with suspected interaction partners

  • Isothermal Titration Calorimetry (ITC): Determine thermodynamic parameters of interactions

In vivo approaches:

  • Co-immunoprecipitation: Isolate RCOM_1282030 complexes from plant tissues

  • Bimolecular Fluorescence Complementation (BiFC): Visualize interactions in plant cells

  • Förster Resonance Energy Transfer (FRET): Measure proximity between RCOM_1282030 and potential partners

The following experimental design can help identify peroxidases that interact with RCOM_1282030:

StepMethodExpected OutcomeControls
1Yeast two-hybrid screeningIdentification of candidate interacting proteinsEmpty vector, unrelated membrane protein
2Co-IP validationConfirmation of interaction in plant tissueNon-specific IgG, unrelated protein antibody
3BiFC in plantaVisualization of interaction in endodermal cellsSplit fluorophore with non-interacting proteins
4Functional assayMeasuring lignification in presence/absence of interactorsCASP mutants, peroxidase inhibitors

CASPs interact with peroxidases to direct lignin deposition and build Casparian strips . Based on this knowledge, it's reasonable to hypothesize that RCOM_1282030 may interact with specific peroxidases in Ricinus communis to perform its function in directing cell wall modification.

How does RCOM_1282030 contribute to the unique properties of Ricinus communis endodermis?

Ricinus communis (castor bean) has adapted to various environmental conditions, and its endodermal barrier properties may reflect these adaptations. To investigate RCOM_1282030's specific contribution to castor bean endodermis, consider:

Comparative analysis approach:

  • Compare RCOM_1282030 sequence with CASP homologs from other species, focusing on the EL1 signature region that is correlated with Casparian strip formation

  • Analyze expression patterns in different root zones and under various stress conditions

  • Examine endodermal ultrastructure in relation to RCOM_1282030 expression levels

Functional complementation studies:

  • Express RCOM_1282030 in Arabidopsis casp mutants to assess functional conservation

  • Create RCOM_1282030 knockdown/knockout lines in Ricinus communis using CRISPR-Cas9

  • Perform physiological measurements of water and nutrient uptake in modified plants

A methodological framework for investigating RCOM_1282030's role in endodermal barrier function:

  • Generate transgenic Ricinus communis lines with altered RCOM_1282030 expression

  • Characterize endodermal development using:

    • Fluorescent marker lines for monitoring Casparian strip formation

    • Apoplastic tracer dyes to assess barrier function

    • Electron microscopy to examine ultrastructural features

  • Measure physiological parameters including:

    • Hydrostatic conductivity of roots

    • Nutrient uptake efficiency

    • Tolerance to abiotic stresses

What experimental approaches can resolve contradictory data regarding RCOM_1282030 function?

When faced with contradictory results in RCOM_1282030 research, a systematic troubleshooting approach is essential. Contradictions may arise from differences in experimental conditions, protein isoforms, or developmental contexts.

Methodological approach to resolve contradictions:

  • Standardize expression and purification protocols
    Ensure consistent protein preparation by documenting detailed protocols including:

    • Expression conditions (temperature, induction time, media composition)

    • Solubilization parameters (detergent type, concentration, time)

    • Purification methods (column types, buffer compositions, elution conditions)

  • Validate protein quality
    Verify that functional studies use properly folded, full-length RCOM_1282030:

    • Confirm molecular weight by SDS-PAGE and mass spectrometry

    • Assess secondary structure by circular dichroism

    • Validate membrane integration using proteoliposomes or nanodiscs

  • Control for experimental variables systematically
    Design experiments to test specific hypotheses about the source of contradiction:

VariableControlled ExperimentOutcome Assessment
Developmental stageTime-course analysisCompare RCOM_1282030 localization/function at defined stages
Environmental conditionsControlled growth chamber experimentsMeasure RCOM_1282030 expression and activity under defined stresses
Genetic backgroundExpression in multiple genetic backgroundsCompare phenotypic effects across backgrounds
Protein interactionsIn vitro reconstitution with defined componentsMeasure activity with/without potential interaction partners
  • Apply multiple independent techniques
    Confirm key findings using complementary approaches:

    • Combine in vitro biochemical assays with in vivo functional studies

    • Use both genetic approaches (mutant analysis) and direct protein studies

    • Employ both imaging-based and biochemical quantification methods

  • Consider post-translational modifications
    Analyze how modifications affect RCOM_1282030 function:

    • Identify modification sites by mass spectrometry

    • Generate modification-mimicking or modification-resistant variants

    • Compare RCOM_1282030 from different expression systems with varying modification capacities

How can I design experiments to study the evolutionary significance of RCOM_1282030?

The evolutionary significance of RCOM_1282030 can be investigated through comparative genomics and functional studies across diverse plant species.

Experimental design approach:

  • Phylogenetic analysis

    • Collect CASP and CASP-like (CASPL) sequences from diverse plant species

    • Construct maximum likelihood phylogenetic trees to trace RCOM_1282030 evolution

    • Identify key residues that have undergone selection during evolution, particularly in the EL1 signature region

  • Functional conservation testing
    Design experiments to test functional conservation across evolutionary distance:

    • Express RCOM_1282030 orthologs from different species in a common genetic background

    • Measure complementation efficiency using quantitative barrier function assays

    • Identify structural features critical for function through chimeric protein approaches

  • Correlation with environmental adaptation
    Investigate whether RCOM_1282030 sequence variation correlates with environmental factors:

    • Compare sequences from plants adapted to different soil conditions

    • Analyze expression patterns under various environmental stresses

    • Test whether variant forms confer differential stress tolerance

The presence of the CASP EL1 signature correlates with the appearance of Casparian strips in plant evolution . This signature is found in all Casparian strip-bearing organisms but is absent in plants like mosses and liverworts that lack Casparian strips . Interestingly, the parasite genus Striga, which has modified root anatomy, still retains a single CASP homolog with a conserved EL1 signature . This evolutionary pattern suggests strong functional constraints on CASP proteins related to their role in Casparian strip formation.

What structural features distinguish RCOM_1282030 from other membrane proteins?

As a CASP family protein, RCOM_1282030 possesses distinctive structural features that enable its specialized function in the endodermis. While detailed structural data for RCOM_1282030 specifically may be limited, insights can be drawn from conserved features of CASP proteins:

The four-transmembrane topology places RCOM_1282030 in the MARVEL (MAL and related proteins for vesicle trafficking and membrane link) protein superfamily . This superfamily is characterized by transmembrane domains that are involved in membrane apposition and specialized membrane domain formation.

Key structural features include:

  • Four membrane-spanning α-helices that anchor the protein in the plasma membrane

  • An extracellular loop 1 (EL1) containing the CASP-specific signature sequence critical for function

  • Conserved residues in transmembrane domains that may facilitate protein-protein interactions and higher-order assembly

  • Cytoplasmic regions that potentially interact with cytoskeletal elements or signaling molecules

Once localized to the Casparian strip membrane domain (CSD), CASP proteins show extremely low turnover despite eventually being removed . This unusual stability likely reflects specialized structural features that allow tight integration into a stable membrane domain.

What methods are most appropriate for analyzing RCOM_1282030 structure-function relationships?

To elucidate structure-function relationships for RCOM_1282030, a multi-faceted experimental approach is required:

Structural analysis methods:

  • X-ray crystallography: Challenging for membrane proteins but could provide high-resolution structural data

  • Cryo-electron microscopy: Increasingly powerful for membrane protein structure determination

  • NMR spectroscopy: Useful for analyzing dynamic regions and ligand interactions

  • Computational modeling: Leverage AlphaFold2 or similar AI tools to predict structure

Functional mapping approaches:

  • Alanine scanning mutagenesis: Systematically replace conserved residues with alanine to identify essential regions

  • Domain swapping: Exchange domains between RCOM_1282030 and other CASP proteins to identify regions responsible for specific functions

  • Deletion analysis: Create truncated versions to map minimal functional domains

Experimental design for structure-function analysis:

The information gained from these approaches can be integrated to develop a comprehensive model of how RCOM_1282030 structure relates to its functions in membrane domain formation and direction of cell wall modification.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.