Recombinant Ricinus communis UPF0392 protein RCOM_0530710 (RCOM_0699480)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RCOM_0699480; Glycosyltransferase family 92 protein RCOM_0530710
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-578
Protein Length
full length protein
Species
Ricinus communis (Castor bean)
Target Names
RCOM_0699480
Target Protein Sequence
MESEQRRKRKRIYKPDSTSNSFFSVRSLTACLSFFVFLLFISSDRSPIKTVSFRPVLNVP VSLLPTPLGLTRDSFDTKSLPLIVEDRVLLPDHVLLIVSNKVATSQNLDCVYSNLYNSHD VVLKPALSVNQYHRDKSIVRCQLPPNNYSAAVYLRWSWEAAEGVAAAAPASVVSWDRVVY EAMLDWNTVAVFVKGLNLRPHKESDSSKFRCHFGLSKFDKDEGIVFTTEAITAAQEVIRC LLPRSIRNNPVKAQGIRVTVSRINAGEDGVDAPLPSVAKVYGAKSYEKRSNRGKYELCAC TMLWNQASFLHEWITYHAWLGVQRWFIYDNNSDDGIQEVVDELNLQNYNVTRHSWPWIKA QEAGFSHCALRARSECKWLGFFDVDEFFYLPRHRGQDMLGENSLRTLVANYSDSSTYAEI RTICHSFGPSGLTSAPSQGVTVGYTCRLQAPERHKSIVRPELLDTTLLNVVHHFKLKEGY RYLNVPESTAVVNHYKYQVWDTFKAKFFRRVSTYVANWQEDQNQGSKDRAPGLGTVAIEP PDWRLRFCEVWDTGLKDFVLANFADTASGYLPWERSPF
Uniprot No.

Target Background

Database Links

KEGG: rcu:8270359

Protein Families
Glycosyltransferase 92 family
Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the UPF0392 protein RCOM_0530710 (RCOM_0699480) and its origin?

The UPF0392 protein RCOM_0530710 (RCOM_0699480) is a protein derived from Ricinus communis (castor bean). This protein belongs to the UPF0392 family, which denotes proteins with uncharacterized protein functions that have been identified through genomic sequencing but lack clear functional characterization. The protein is referenced in biological databases with UniProt accession numbers B9S2H4 (for RCOM_0699480) and B9SLR1 (for RCOM_0530710), indicating they may be variants or related proteins within the same family. Ricinus communis is widely studied for its therapeutic properties, including antibacterial, antifungal, anti-inflammatory, leishmanicidal, and mosquitocidal effects, making proteins from this species particularly interesting for pharmacological research .

What is the amino acid composition and sequence characteristics of the UPF0392 protein?

The UPF0392 protein RCOM_0530710 (RCOM_0699480) is a full-length protein consisting of 578 amino acids. Its amino acid sequence begins with MESEQRRKRKRIYKPDSTSNSFFSVRSLTACLSFFVFLLFISSDRSPIKTVSFRPVLNVPVSLLPTPLGLTRDSFDTKSLPLIVEDRVLLPDHVLLIVSNKVATSQNLDCVYSNLYNSHDVVLKPALSVNQYHRDKSIVRCQLPPNNYSAAVYLRWSWEAAEGVAAAAPASVVSWDRVVYEAMLDWNTVAVFVKGLNLRPHKESDSSKFRCHFGLSKFDKDEGIVFTTEAITAAQEVIRCLLPRSIRNNPVKAQGIRVTVSRINAGEDGVDAPLPSVAKVYGAKSYEKRSNRGKYELCACTMLWNQASFLHEWITYHAWLGVQRWFIYDNNSDDGIQEVVDELNLQNYNVTRHSWPWIKAQEAGFSHCALRARSECKWLGFFDVDEFFYLPRHRGQDMLGENSLRTLVANYSDSSSTYAEIRTICHSFGPSGLTSAPSQGVTVGYTCRLQAPERHKSIVRPELLDTTLLNVVHHFKLKEGYRYLNVPESTAVVNHYKYQVWDTFKAKFFRRVSTYVANWQEDQNQGSKDRAPGLGTVAIEPPDWRLRFCEVWDTGLKDFVLANFADTASGYLPWERSPF . This sequence contains multiple functional domains that may contribute to its biological activities, though specific domain functions remain largely uncharacterized.

How do RCOM_0530710 and RCOM_0699480 relate to each other?

Based on the available data, RCOM_0530710 and RCOM_0699480 appear to be related protein variants from Ricinus communis. RCOM_0699480 is referenced with UniProt number B9S2H4 and consists of 578 amino acids , while RCOM_0530710 is associated with UniProt number B9SLR1 and comprises 552 amino acids . Their sequence homology suggests they may be paralogs (genes related by duplication within the genome) or represent different splice variants of the same gene. Sequence alignment analysis would reveal their exact relationship, highlighting conserved regions that may be essential for function versus divergent regions that might confer specialized activities. Researchers should be aware of these distinctions when designing experiments to ensure they are working with the specific variant relevant to their research question .

What are optimal storage conditions for maintaining UPF0392 protein stability?

For optimal stability of recombinant UPF0392 protein, storage should follow these evidence-based protocols: The protein should be kept in a Tris-based buffer with 50% glycerol that has been optimized specifically for this protein's stability . For short-term storage (up to one week), maintain working aliquots at 4°C. For medium-term storage, keep the protein at -20°C. For long-term preservation, store at either -20°C or -80°C depending on anticipated storage duration . To prevent protein degradation, avoid repeated freeze-thaw cycles which can significantly compromise structural integrity and biological activity . Instead, prepare single-use aliquots upon receipt. When designing experiments involving thermal stability assessment, researchers should include control samples stored under optimal conditions alongside experimental conditions to accurately quantify stability differences.

What expression systems and purification strategies yield highest-quality recombinant UPF0392 protein?

E. coli represents the most commonly employed expression system for recombinant Ricinus communis UPF0392 protein as evidenced by commercial preparations . For optimal expression, researchers should consider these methodological approaches: (1) Codon optimization of the RCOM_0530710/RCOM_0699480 sequence for E. coli expression is essential to overcome potential rare codon limitations; (2) Inclusion of a histidine tag facilitates efficient purification while maintaining protein functionality; (3) Expression temperature should be optimized—typically lower temperatures (16-18°C) reduce inclusion body formation; (4) Purification via immobilized metal affinity chromatography (IMAC) followed by size exclusion chromatography provides highest purity. For quality control, SDS-PAGE analysis should demonstrate >95% purity, while mass spectrometry confirmation ensures proper protein identity and integrity. When working with a protein containing numerous cysteine residues like UPF0392, incorporation of reducing agents in purification buffers helps prevent disulfide bond formation and protein aggregation.

How can researchers verify the structural integrity and functionality of purified UPF0392 protein?

Verification of UPF0392 protein integrity requires a multi-faceted analytical approach. Begin with SDS-PAGE analysis under both reducing and non-reducing conditions to assess purity and potential oligomerization. Circular dichroism (CD) spectroscopy should be performed to confirm proper secondary structure formation, comparing results against predicted structural elements from bioinformatic analysis. Thermal shift assays can determine protein stability under various buffer conditions, identifying optimal formulations for subsequent experiments. For functional verification, although specific enzymatic activities of UPF0392 remain uncharacterized, researchers can employ biomolecular interaction techniques such as surface plasmon resonance (SPR) or microscale thermophoresis (MST) to detect binding with potential interactors predicted through bioinformatic analysis. Additionally, limited proteolysis followed by mass spectrometry analysis can identify stable domains and verify proper folding. All quality control data should be documented with appropriate positive controls to establish baseline expectations for properly functioning UPF0392 protein.

How might UPF0392 protein contribute to Ricinus communis physiological properties?

Current research indicates that Ricinus communis possesses multiple pharmacological properties including antibacterial, antifungal, anti-inflammatory, leishmanicidal, and mosquitocidal activities . While the specific contribution of UPF0392 protein to these properties remains uncharacterized, its structural features suggest potential roles worth investigating. The protein's sequence contains multiple domains that may participate in host defense mechanisms. Research approaches to elucidate UPF0392's physiological role should include: (1) Gene knockout/knockdown studies in Ricinus communis to observe phenotypic changes; (2) Heterologous expression followed by activity assays against microbial targets; (3) Localization studies to determine tissue distribution patterns that might correlate with defense-related functions. Of particular interest is the observed antimicrobial activity of Ricinus communis against resistant strains such as methicillin-resistant Enterococcus faecalis and Staphylococcus aureus . Researchers should design experiments that specifically test whether UPF0392 contributes to these antimicrobial effects by comparing the activity of plant extracts with and without immunodepletion of the protein.

What computational approaches can predict potential functions of UPF0392 protein?

Given the uncharacterized nature of UPF0392 protein, computational approaches represent essential tools for function prediction. Researchers should implement a comprehensive bioinformatic pipeline including: (1) Sequence-based homology modeling using the SWISS-MODEL or I-TASSER servers to generate three-dimensional structural predictions; (2) Structure-based function prediction via tools like ProFunc or COFACTOR that identify potential binding sites and catalytic residues; (3) Molecular dynamics simulations to assess conformational stability and flexibility of predicted structures; (4) Genomic context analysis to identify co-regulated genes that might share functional relationships with UPF0392; (5) Evolutionary analysis across species to identify conserved regions under selective pressure, indicating functional importance. Additionally, protein-protein interaction prediction using tools like STRING can generate testable hypotheses about biological pathways involving UPF0392. These computational predictions should be systematically validated through targeted experimental approaches, beginning with the highest-confidence predictions.

How can UPF0392 protein be utilized in studies examining antimicrobial mechanisms?

Research indicates that Ricinus communis extracts demonstrate significant antibacterial activity against clinically relevant pathogens, including methicillin-resistant Staphylococcus aureus . To investigate whether UPF0392 protein contributes to these antimicrobial properties, researchers should employ these methodological approaches: (1) Purified recombinant UPF0392 protein should be tested in minimum inhibitory concentration (MIC) assays against bacterial panels including both Gram-positive and Gram-negative species; (2) Mechanism studies using membrane permeabilization assays to determine if UPF0392 acts similarly to sodium ricinoleate (another Ricinus communis component) which disrupts microbial cell membranes ; (3) Biofilm inhibition assays to assess UPF0392's potential to prevent bacterial adhesion and colonization; (4) Structure-function relationship studies using truncated protein constructs to identify antimicrobial domains; (5) Combination studies with conventional antibiotics to identify potential synergistic effects. These approaches would not only characterize UPF0392's antimicrobial potential but could also identify novel antimicrobial mechanisms and therapeutic applications.

What strategies can address solubility and stability challenges with recombinant UPF0392 protein?

Recombinant UPF0392 protein may present solubility challenges due to its complex structure. Researchers encountering such difficulties should implement these evidence-based strategies: (1) Buffer optimization through systematic screening of pH ranges (6.0-9.0), salt concentrations (50-500 mM NaCl), and additives (glycerol, arginine, trehalose); (2) Fusion tag approaches—beyond the standard His-tag, consider solubility-enhancing tags such as SUMO, MBP, or Trx, with subsequent tag removal via specific proteases; (3) Refolding protocols from inclusion bodies using stepwise dialysis with decreasing denaturant concentrations if soluble expression fails; (4) Co-expression with molecular chaperones such as GroEL/GroES or trigger factor to assist proper folding; (5) Implementation of the "sparse matrix" approach to systematically identify optimal solubilization conditions. For long-term stability, researchers should conduct accelerated stability studies at different temperatures (4°C, 25°C, 37°C) and in various buffer compositions to identify formulations that minimize aggregation and degradation. Additionally, circular dichroism spectroscopy can be employed to monitor structural integrity over time under different storage conditions.

How should researchers troubleshoot inconsistent results in UPF0392 protein experiments?

When encountering reproducibility challenges with UPF0392 protein experiments, researchers should implement this systematic troubleshooting framework: (1) Protein quality assessment—verify batch-to-batch consistency using SDS-PAGE, western blotting, and mass spectrometry; implement rigorous quality control thresholds before proceeding with experiments; (2) Environmental variables—standardize experimental conditions including temperature, pH, and ionic strength, documenting all parameters meticulously; (3) Reagent validation—test all buffers for contamination and confirm accurate preparation; verify antibody specificity with appropriate controls; (4) Technical execution—implement detailed standard operating procedures (SOPs) and validate instrument calibration regularly; (5) Statistical approach—determine appropriate sample sizes through power analysis and implement robust statistical methods resistant to outliers. Additionally, researchers should establish a validation pipeline where key experiments are replicated by different laboratory members using independent protein preparations. For collaborative multi-site studies involving UPF0392, implementing a centralized protein source or detailed standardization protocols can significantly reduce inter-laboratory variation.

What experimental controls are essential when studying potential protein-protein interactions involving UPF0392?

When investigating protein-protein interactions (PPIs) involving UPF0392 protein, these methodologically rigorous controls must be implemented: (1) For pull-down assays: include tag-only controls to identify false positives from tag-mediated interactions; use denatured UPF0392 controls to distinguish specific from non-specific binding; and implement competition assays with unlabeled protein to confirm binding site specificity; (2) For co-immunoprecipitation: perform reciprocal co-IPs to verify interactions from both protein perspectives; include isotype control antibodies to assess non-specific binding; and validate antibody specificity with knockout/knockdown samples; (3) For biophysical methods (SPR, ITC, BLI): include proper reference surfaces; perform careful concentration series measurements to enable kinetic and thermodynamic parameter calculation; and design competition experiments to confirm binding site specificity. Additionally, researchers should employ orthogonal validation using multiple independent techniques (e.g., validate a co-IP result with proximity ligation assay). For high-throughput interaction screening, implement stringent statistical filtering and secondary validation of all hits with at least two independent methodologies.

How might UPF0392 protein research contribute to understanding Ricinus communis therapeutic properties?

Ricinus communis demonstrates multiple therapeutic properties that could potentially involve UPF0392 protein contributions. Research strategies to investigate this connection should include: (1) Comparative proteomics between different Ricinus communis extracts with varying therapeutic potencies to correlate UPF0392 expression levels with biological activities; (2) Immunodepletion studies removing UPF0392 from active extracts to quantify activity reduction; (3) Structure-based virtual screening to identify potential interactions between UPF0392 and known therapeutic targets. Of particular interest is exploring UPF0392's potential role in the documented anti-inflammatory properties of Ricinus communis, which demonstrate faster therapeutic impact on inflammation compared to other medications . Additionally, researchers should investigate whether UPF0392 contributes to the synergistic effects observed when Ricinus communis extracts are combined with other plant extracts, such as the enhanced leishmanicidal activity (88% efficacy) observed when combined with Azadirachta indica extract . These investigations could provide valuable insights into multi-component therapeutic mechanisms.

What methodologies can identify potential roles of UPF0392 in mosquitocidal activity?

Given that Ricinus communis extracts demonstrate potent larvicidal activity against multiple mosquito species with nearly 100% fatality rates , researchers should employ these approaches to investigate UPF0392's potential contribution: (1) Bioactivity-guided fractionation of Ricinus communis extracts, tracking UPF0392 protein concentration across fractions with differential larvicidal activity; (2) Recombinant UPF0392 protein exposure assays using mosquito larvae (Culex quinquefasciatus, Anopheles stephensi, and Anopheles albopictus) with precise LC50 determination; (3) Mechanism studies examining larvae exposed to UPF0392 protein for morphological changes, membrane disruption, and developmental abnormalities; (4) Structure-activity relationship studies using modified or truncated UPF0392 constructs to identify active domains; (5) Synergy assessment between UPF0392 and other known larvicidal compounds from Ricinus communis. This research direction is particularly significant given the varied lethal concentrations observed across different mosquito species: Culex quinquefasciatus (7.10 μg/mL), Anopheles stephensi (11.64 μg/mL), and Anopheles albopictus (16.84 μg/mL) , suggesting species-specific mechanisms that could be exploited for targeted vector control strategies.

How can researchers investigate UPF0392 protein in relation to antibacterial mechanisms?

To systematically investigate UPF0392's potential antibacterial properties, researchers should implement this experimental framework: (1) Activity spectrum determination—conduct standardized minimum inhibitory concentration (MIC) and minimum bactericidal concentration (MBC) assays against clinical isolates, particularly those mentioned in Ricinus communis research including methicillin-resistant Enterococcus faecalis, Escherichia coli, Staphylococcus aureus, and Streptococcus mutans ; (2) Mechanism elucidation—perform membrane permeabilization assays using fluorescent dyes to determine if UPF0392 acts similarly to sodium ricinoleate which disrupts bacterial cell membranes ; (3) Synergy assessment—conduct checkerboard assays to evaluate potential synergistic effects between UPF0392 and conventional antibiotics; (4) Resistance development—perform serial passage experiments to assess the potential for resistance development against UPF0392; (5) In vivo efficacy—test purified UPF0392 in animal infection models to validate in vitro findings. Additionally, researchers should investigate whether UPF0392 contributes to biofilm inhibition properties, which would represent a valuable attribute given the clinical challenges posed by biofilm-forming pathogens.

How can genomic and transcriptomic approaches enhance understanding of UPF0392 protein function?

To elucidate UPF0392 protein function through genomic and transcriptomic analyses, researchers should implement these methodological approaches: (1) Comparative genomic analysis across Ricinus communis variants and related species to identify evolutionary conservation patterns and selection pressures on the UPF0392 gene; (2) Transcriptomic profiling of Ricinus communis under various stress conditions (pathogen exposure, abiotic stresses) to identify conditions that modulate UPF0392 expression; (3) Co-expression network analysis to identify genes with expression patterns correlated with UPF0392, potentially revealing functional associations; (4) eQTL (expression quantitative trait loci) mapping to identify genetic variants affecting UPF0392 expression levels; (5) SNP-level detection methods to identify functional variants within UPF0392 gene . Additionally, researchers should consider implementing CRISPR-based genome editing in model systems to generate UPF0392 knockouts, enabling phenotypic characterization. These genomic and transcriptomic approaches would provide valuable contextual information about UPF0392's biological role and regulatory mechanisms, complementing direct biochemical and structural studies.

What experimental design is optimal for identifying potential binding partners of UPF0392 protein?

To comprehensively identify UPF0392 protein interactors, researchers should implement this tiered experimental approach: (1) Initial screening via affinity purification-mass spectrometry (AP-MS)—immobilize tagged UPF0392 on affinity resin and incubate with Ricinus communis extract, followed by stringent washing and mass spectrometric identification of bound proteins; include appropriate negative controls (tag-only, unrelated protein) and perform experiments in biological triplicate with statistical filtering of results; (2) Validation of high-confidence interactions through reciprocal co-immunoprecipitation; (3) Direct binding confirmation using purified proteins via biophysical methods including isothermal titration calorimetry (ITC), surface plasmon resonance (SPR), or microscale thermophoresis (MST) to determine binding affinities and kinetics; (4) Mapping of interaction interfaces through hydrogen-deuterium exchange mass spectrometry (HDX-MS) or chemical cross-linking coupled with MS (XL-MS); (5) Functional validation through co-localization studies and mutational analysis disrupting predicted interaction interfaces. Additionally, researchers should consider proximity-dependent biotin identification (BioID) or APEX proximity labeling as complementary approaches to identify transient or weak interactors that might be missed by traditional affinity purification methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.