Recombinant Rickettsia africae Lipoprotein signal peptidase (lspA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on purchasing method and location. Consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
lspA; RAF_ORF0520; Lipoprotein signal peptidase; Prolipoprotein signal peptidase; Signal peptidase II; SPase II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-201
Protein Length
full length protein
Species
Rickettsia africae (strain ESF-5)
Target Names
lspA
Target Protein Sequence
MLPLLKKLYLTFARSSRIIITLVIIDQLSKWWFIDNLRWKPDLMLKFTSFLNMVYTWNYG ISFGLMREYYQYSNAIFLITNTIIVCYLYYLMIRSKTIGSFAGYSFVIGGAVGNLIDRFF RGAVFDFIHFHYQNYSFPVFNLADCFITIGVIILIEDYYSTKKVIEEKAKGNYDNAQIEA MAEKIRNTDKGGNDKIASLQN
Uniprot No.

Target Background

Function

This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Database Links
Protein Families
Peptidase A8 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the lspA gene in Rickettsia and what function does it serve?

The lspA gene encodes type II signal peptidase (SPase II), an essential enzyme in gram-negative bacteria that processes prolipoproteins into mature lipoproteins. In Rickettsia, as demonstrated in R. typhi, lspA contains highly conserved residues and domains essential for SPase II activity in lipoprotein processing. This processing is critical for bacterial intracellular growth and virulence . The gene functions within a coordinated system alongside other processing enzymes like lgt (prolipoprotein transferase) and works differently from lepB (type I signal peptidase), which is involved in non-lipoprotein secretion .

What is the geographical distribution of Rickettsia africae?

R. africae is predominantly found in western, central, and southern Africa. Recent research has expanded the known range of this pathogen, with the northernmost reported isolation in western Africa and first-time identification in Kenya . The pathogen's distribution correlates with that of its tick vectors, primarily Amblyomma variegatum and A. hebraeum. Molecular detection techniques have revealed that R. africae may be more widespread than previously thought, particularly in areas where tick vectors are endemic .

How does Rickettsia africae differ from other Rickettsia species at the genetic level?

R. africae belongs to the spotted fever group (SFG) rickettsiae and shows genetic distinctions from other species like R. conorii. Surface proteins such as rOmpA and rOmpB show evidence of intense positive natural selection between species, causing rapid diversification of amino acid sequences . While specific data on lspA variation between R. africae and other species isn't directly provided in the search results, studies have shown that rickettsial genes, including those involved in lipoprotein processing, exhibit evidence of recombination between species, though at sufficiently infrequent rates that phylogenies of different genes remain similar but not identical .

What are the optimal conditions for expressing recombinant R. africae lspA in E. coli expression systems?

Based on successful expression of R. typhi lspA, researchers should consider the following methodology: Use pSY5 plasmid vector systems for expression in E. coli, which has proven effective for rickettsial protein expression . The expression construct should contain the complete coding sequence of lspA with appropriate promoter and terminator sequences. Optimal induction conditions typically involve IPTG at concentrations of 0.1-1.0 mM, with expression at 30°C rather than 37°C to improve protein solubility. Verification of functional activity can be performed through complementation assays using temperature-sensitive E. coli strains (like E. coli Y815) at nonpermissive temperatures, as demonstrated for R. typhi lspA . Additionally, globomycin resistance assays can confirm SPase II activity of the recombinant protein .

How can researchers validate the functionality of recombinant R. africae lspA?

Functional validation requires multiple approaches:

  • Genetic Complementation: Transform temperature-sensitive E. coli strains defective in SPase II activity (such as E. coli Y815) with the recombinant lspA construct and assess growth restoration at nonpermissive temperatures .

  • Globomycin Resistance Assay: Overexpression of functional SPase II confers increased resistance to globomycin, a specific inhibitor of SPase II. Compare growth of E. coli expressing R. africae lspA versus controls in media containing varying globomycin concentrations .

  • Enzymatic Activity Assay: Using synthetic prolipoprotein substrates, monitor the cleavage activity of the purified recombinant enzyme through techniques such as mass spectrometry or gel electrophoresis.

  • Structural Analysis: Confirm proper protein folding through circular dichroism or limited proteolysis to ensure the recombinant protein maintains the structural features necessary for enzymatic activity.

What purification strategies yield the highest purity and activity of recombinant R. africae lspA?

For optimal purification of recombinant R. africae lspA, researchers should employ a multi-step approach:

  • Affinity Chromatography: Use His-tag or other fusion tags for initial capture, with careful selection of detergents (typically mild non-ionic detergents like DDM or Triton X-100) to maintain membrane protein activity.

  • Size Exclusion Chromatography: Remove aggregates and separate monomeric from oligomeric forms.

  • Ion Exchange Chromatography: Further purify based on the predicted isoelectric point of R. africae lspA.

The critical factor is maintaining the native conformation and activity of this membrane-associated enzyme throughout purification. Stability assessment at each purification step is essential, and activity assays should be performed to ensure the functional integrity of the purified protein. Based on experiences with other rickettsial recombinant proteins, adding stabilizing agents like glycerol (10-15%) and avoiding freeze-thaw cycles can help preserve enzymatic activity .

How can R. africae lspA be utilized for developing diagnostic tools for African tick-bite fever?

Recombinant R. africae lspA holds potential as a diagnostic biomarker for African tick-bite fever, though research in this specific application is still developing. Based on successful approaches with other rickettsial recombinant proteins, researchers should consider:

  • ELISA Development: Establish a recombinant protein ELISA system similar to those developed for OmpA and OmpB, which have demonstrated utility in diagnosing rickettsial infections . This would require optimization of protein coating concentration, blocking conditions, and determination of appropriate cutoff values for sensitivity and specificity.

  • Multiplex Approaches: Combine lspA with other rickettsial antigens (such as OmpA and OmpB) to improve diagnostic accuracy. Research has shown that a panel approach can yield better sensitivity and specificity than single-antigen detection .

  • Validation Studies: Test the assay against well-characterized serum panels from both infected patients and healthy controls, with careful statistical analysis to determine sensitivity, specificity, and cross-reactivity with other rickettsial species .

When developing such assays, researchers should aim for sensitivity and specificity exceeding 70% to match or exceed current diagnostic approaches. The recombinant protein approach offers advantages over whole-cell antigen preparations, particularly in low-resource settings, as it requires only BSL-2 rather than BSL-3 facilities for production .

How do transcription patterns of lspA change during different phases of R. africae intracellular growth?

While specific data on R. africae lspA transcription patterns aren't directly available in the search results, insights can be drawn from R. typhi studies. In R. typhi, real-time quantitative reverse transcription-PCR revealed differential expression of lspA during various stages of rickettsial intracellular growth . Most notably:

  • Preinfection Phase: Higher transcriptional levels of lspA, lgt, and lepB were observed, suggesting that only metabolically active rickettsiae capable of active protein processing can successfully establish infection .

  • Growth Phase Dynamics: lspA and lgt (both involved in lipoprotein processing) showed similar expression patterns, distinct from lepB (involved in non-lipoprotein secretion) .

For researchers studying R. africae lspA expression, similar methodological approaches using qRT-PCR should be employed, with careful normalization against housekeeping genes and time-course experiments capturing preinfection, early infection, mid-growth, and stationary phases within host cells. RNA extraction protocols optimized for intracellular bacteria would be critical for accurate results.

What is the evolutionary significance of lspA in relation to Rickettsia pathogenicity and host adaptation?

The evolutionary aspects of lspA in Rickettsia must be considered within the broader context of evolutionary processes affecting rickettsial antigens and surface proteins. While the search results don't directly address lspA evolution in R. africae, several relevant patterns have been observed in rickettsial evolution:

  • Selective Pressure: Unlike surface proteins such as rOmpA and rOmpB which show evidence of intense positive selection and rapid diversification between species, intracytoplasmic antigens typically show less evidence of positive selection . As a membrane-associated processing enzyme, lspA likely faces different selective pressures than direct immune targets.

  • Recombination Evidence: Rickettsial genes show evidence of recombination between species, which contributes to genetic diversity . This recombination, though infrequent, may affect lspA evolution and could be investigated through comparative genomic approaches.

  • Functional Conservation: The highly conserved catalytic domains in SPase II suggest functional constraints on evolution, as the enzyme's role in lipoprotein processing is critical for bacterial viability and virulence .

Researchers investigating lspA evolution should employ selection analysis methods such as dN/dS ratio calculations and tests for recombination using methods like those described in the research on other rickettsial genes .

How can researchers overcome the challenges of expressing membrane-associated proteins like lspA?

Expressing membrane-associated proteins such as lspA presents several challenges that researchers can address through specific strategies:

  • Expression System Selection:

    • Use E. coli strains specifically designed for membrane protein expression (C41, C43, or Lemo21)

    • Consider cell-free expression systems which have proven effective for difficult membrane proteins

    • Alternative expression hosts like insect cells may provide better folding environments for complex proteins

  • Optimization Strategies:

    • Lower induction temperatures (16-25°C) to slow protein synthesis and improve folding

    • Reduce inducer concentration to prevent overwhelming the membrane insertion machinery

    • Co-express chaperones that assist in membrane protein folding

  • Solubilization Approaches:

    • Systematically screen detergents or detergent mixtures for optimal extraction

    • Consider amphipols or nanodiscs for stabilizing the protein after extraction

    • Use fusion partners specifically designed for membrane proteins

  • Functional Assessment:

    • Implement activity assays at early stages to verify proper folding

    • Conduct limited proteolysis to verify structural integrity

Researchers working with R. africae lspA should be particularly attentive to the membrane topology of the expressed protein, as improper membrane insertion will result in non-functional enzyme.

What are the critical controls needed when analyzing R. africae lspA activity in experimental settings?

When analyzing R. africae lspA activity, researchers must implement comprehensive controls:

  • Negative Controls:

    • Catalytically inactive lspA mutant (created by site-directed mutagenesis of conserved catalytic residues)

    • Reactions performed in the presence of SPase II inhibitors like globomycin

    • Heat-inactivated enzyme preparations

  • Positive Controls:

    • Well-characterized SPase II from model organisms (E. coli LspA)

    • If available, native R. africae preparations from cultured organisms

  • Specificity Controls:

    • Substrate specificity assessment using both canonical and non-canonical prolipoprotein sequences

    • Confirmation that type I signal peptidase substrates are not processed

  • System Controls:

    • In complementation assays: empty vector transformants

    • In biochemical assays: background processing assessment in the absence of added enzyme

  • Quantitative Standards:

    • Standard curves for product formation

    • Time-course measurements to establish linear range of the assay

These controls help distinguish genuine enzymatic activity from artifacts and provide benchmarks for comparing results across different experimental conditions or between different research groups.

How should researchers address potential cross-reactivity when developing serological assays based on recombinant R. africae lspA?

Addressing cross-reactivity in serological assays based on recombinant R. africae lspA requires systematic evaluation and optimization:

  • Cross-Reactivity Assessment Protocol:

    • Test against serum panels containing antibodies to other rickettsial species, particularly R. conorii and R. typhi

    • Include samples from patients with confirmed non-rickettsial infections that present similar clinical symptoms

    • Evaluate potential cross-reactivity with antibodies against other gram-negative bacterial pathogens

  • Epitope Refinement:

    • Identify unique epitopes specific to R. africae lspA through epitope mapping

    • Consider using only specific domains rather than the full-length protein

    • Implement peptide-based approaches targeting regions with minimal sequence homology to other species

  • Assay Optimization:

    • Adjust antigen concentration to maximize the signal-to-noise ratio

    • Optimize serum dilutions to minimize non-specific binding

    • Evaluate different blocking agents to reduce background signals

  • Advanced Approaches:

    • Develop competitive ELISA formats where specific inhibitors can confirm binding specificity

    • Implement pre-absorption steps with heterologous antigens to remove cross-reactive antibodies

    • Consider multiplex approaches with algorithms that account for cross-reactivity patterns

Based on experiences with other rickettsial recombinant protein ELISAs, researchers should aim for specificity values exceeding 70% while maintaining adequate sensitivity .

What statistical approaches are most appropriate for analyzing experimental data from R. africae lspA studies?

The statistical analysis of experimental data from R. africae lspA studies requires tailored approaches depending on the specific experimental design:

  • Enzyme Kinetics Analysis:

    • Non-linear regression models for determining Km and Vmax parameters

    • Lineweaver-Burk or Eadie-Hofstee transformations for visual representation of kinetic data

    • Analysis of inhibition patterns using appropriate models (competitive, non-competitive, uncompetitive)

  • Gene Expression Studies:

    • Normalization against multiple reference genes using algorithms like geNorm or NormFinder

    • ANOVA with post-hoc tests for multiple time-point comparisons

    • Non-parametric alternatives when assumptions of normality are violated

  • Diagnostic Test Development:

    • ROC curve analysis to determine optimal cutoff values

    • Calculation of sensitivity, specificity, positive and negative predictive values

    • Cohen's kappa for agreement assessment with gold standard methods

  • Evolutionary Studies:

    • Maximum likelihood methods for selection analysis

    • Bayesian approaches for phylogenetic reconstruction

    • Statistical tests for detecting recombination events

  • Structure-Function Analysis:

    • Multiple sequence alignment significance testing

    • Structural comparison metrics like RMSD

    • Statistical coupling analysis for co-evolving residues

Researchers should report effect sizes and confidence intervals alongside p-values and ensure appropriate correction for multiple testing when applicable.

How can researchers differentiate between R. africae lspA activity and other signal peptidases in experimental settings?

Differentiating R. africae lspA (SPase II) activity from other signal peptidases requires specialized approaches:

  • Substrate Specificity:

    • SPase II specifically cleaves prolipoproteins after the lipobox motif (typically L-A/S-G/A-C)

    • Design synthetic substrates containing the canonical lipobox motif and confirm they're not processed by SPase I

  • Inhibitor Profiles:

    • SPase II is specifically inhibited by globomycin while remaining insensitive to most SPase I inhibitors

    • Conduct parallel assays with specific inhibitors to differentiate enzymatic activities

  • Biochemical Distinctions:

    • SPase II requires prior lipid modification of the substrate by prolipoprotein diacylglyceryl transferase (Lgt)

    • Perform sequential enzyme assays where the substrate is first treated with Lgt before lspA exposure

  • Genetic Approaches:

    • In complementation assays, SPase II specifically rescues lspA mutants but not lepB mutants

    • Engineer reporter systems that specifically respond to lipoprotein processing

  • Computational Prediction:

    • Use bioinformatic tools to distinguish between SPase I and SPase II substrates in the proteome

    • Validate these predictions experimentally to confirm SPase II specificity

These methodological approaches ensure that the observed activity is genuinely attributable to R. africae lspA rather than to other peptidases that might be present in the experimental system.

What computational tools and algorithms are recommended for analyzing the structural and functional aspects of R. africae lspA?

For comprehensive analysis of structural and functional aspects of R. africae lspA, researchers should employ the following computational tools and algorithms:

  • Sequence Analysis:

    • SignalP and LipoP for signal peptide and lipobox prediction

    • TMHMM or HMMTOP for transmembrane domain prediction

    • Multiple sequence alignment tools (MUSCLE, T-Coffee) for evolutionary conservation analysis

    • ConSurf for mapping conservation onto structural models

  • Structural Prediction and Analysis:

    • AlphaFold2 or RoseTTAFold for ab initio structural prediction

    • MODELLER for homology modeling if templates are available

    • MDAnalysis for molecular dynamics simulation analysis

    • PyMOL or UCSF Chimera for structural visualization and analysis

  • Functional Site Prediction:

    • 3DLigandSite or COACH for binding site prediction

    • POOL or Evolutionary Trace for functional residue prediction

    • Site-Directed Mutator for predicting the effect of mutations

  • Systems Biology Integration:

    • STRING for protein-protein interaction network analysis

    • KEGG Mapper for pathway integration

    • Cytoscape for network visualization and analysis

  • Evolutionary Analysis:

    • PAML for detection of selection signatures

    • LDhat or similar tools for recombination detection

    • BEAST for Bayesian evolutionary analysis

These tools should be used in combination to develop comprehensive models of R. africae lspA structure, function, and evolution, informing experimental design and interpretation of results.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.