Recombinant Rickettsia africae Probable intracellular septation protein A (RAF_ORF0501)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is expressed in Escherichia coli (E. coli) and purified using affinity chromatography. Key specifications include:

ParameterDetails
Expression SystemE. coli
Purity>90% (SDS-PAGE) ; >85% in ELISA formulations
StorageLyophilized powder in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution0.1–1.0 mg/mL in sterile water; 5–50% glycerol recommended
StabilityStable at -20°C/-80°C; avoid repeated freeze-thaw cycles

Biological Role in Rickettsia africae

RAF_ORF0501 is hypothesized to facilitate intracellular septation, a process critical for bacterial replication within host cells. Phylogenetic analyses of its ompA and ompB genes confirm its classification within the spotted fever group rickettsiae (SFGR), closely related to R. africae strains . Key findings include:

  • Genetic Homology: The ompB gene of RAF_ORF0501 shows 100% nucleotide homology with R. tamurae (DQ113910) and high homology with R. africae (EU622980) .

  • Pathogenicity Link: R. africae utilizes septation proteins to evade host immune responses, enabling persistent infection in ticks and mammals .

Research Applications

RAF_ORF0501 is primarily used in:

  • ELISA Development: Commercial kits employ recombinant RAF_ORF0501 to detect R. africae antibodies in clinical samples .

  • Pathogenesis Studies: Its role in bacterial division and host-cell interaction is examined using knockout mutants .

  • Vaccine Development: Antigenicity studies explore its potential as a vaccine candidate against ATBF .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order. We will accommodate your request as best as possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please communicate with us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a final concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use to minimize freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us and we will prioritize its development.
Synonyms
yciB; RAF_ORF0501; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Rickettsia africae (strain ESF-5)
Target Names
RAF_ORF0501
Target Protein Sequence
MLKLLSEIGPVIAFFAGFFYGGGIQHATLYMLITSVICITLCYVIDKKVSKLSIISTTVL LVSGSITLISGDSMYIKIKPTILYVIFGIIFLMSGIRKNPFIKYALESIVRLKEESWITL SYRTAAFFFFMAVVNEVVWRNCSDETWVKFKVFGVIPITFIFILLQLPLLLKNKLPDSKI
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rickettsia africae and how does it relate to African tick-bite fever?

Rickettsia africae is an obligate intracellular bacterium belonging to the spotted fever group of Rickettsia species. It is the etiological agent of African tick-bite fever, a disease primarily transmitted by ticks in sub-Saharan Africa and the Caribbean. Clinical documentation shows cases occurring in travelers returning from endemic regions, as evidenced by a reported case in a Brazilian traveler after returning from South Africa .

The bacterium typically infects endothelial cells and can cause symptoms including fever, headache, myalgia, and characteristic eschars at tick bite sites. Understanding the molecular components of R. africae, including proteins like RAF_ORF0501, is essential for elucidating pathogenesis mechanisms and developing potential therapeutic interventions.

What is the function of the probable intracellular septation protein A (RAF_ORF0501) in Rickettsia africae?

The probable intracellular septation protein A (RAF_ORF0501) in Rickettsia africae is hypothesized to play a critical role in bacterial cell division processes. While direct research on RAF_ORF0501 is limited in available literature, we can draw insights from studies on related rickettsial proteins.

Septation proteins typically function in bacterial cell division by facilitating septum formation, which divides the bacterial cell during replication. In obligate intracellular bacteria like Rickettsia, these processes must adapt to their unique lifestyle within host cells. RAF_ORF0501 likely contributes to the spatial and temporal regulation of septum formation, ensuring proper bacterial replication within the intracellular environment.

By analogy to research on virulence determinants in related species like R. rickettsii , proper septation appears crucial for effective intracellular replication and survival, potentially contributing to the pathogen's virulence and ability to establish persistent infection.

How does RAF_ORF0501 compare structurally to septation proteins in other bacterial species?

While not directly addressed in the search results, comparative genomic approaches can reveal important relationships between RAF_ORF0501 and other bacterial septation proteins. The structural features likely include:

  • Domains involved in GTP binding and hydrolysis (if RAF_ORF0501 belongs to the FtsZ family)

  • Potential membrane-interaction regions

  • Protein-protein interaction interfaces for recruiting other divisome components

  • Specialized adaptations for the intracellular lifestyle of Rickettsia

Understanding these structural elements requires experimental approaches such as X-ray crystallography, cryo-electron microscopy, or computational modeling based on homologous proteins with known structures. Comparison with septation proteins from model organisms like E. coli can highlight rickettsial-specific adaptations related to their obligate intracellular lifestyle.

What are key factors to consider when designing experiments to study RAF_ORF0501 expression?

Designing rigorous experiments to study RAF_ORF0501 expression requires carefully defining variables and implementing appropriate controls as outlined in experimental design principles :

  • Clearly defined variables:

    • Independent variables: Conditions affecting RAF_ORF0501 expression (growth phase, host cell type, environmental stressors)

    • Dependent variables: Measurable outcomes (protein levels, localization patterns, functional impacts)

    • Control variables: Factors kept consistent across experimental conditions

  • Temporal considerations:

    • Sampling at multiple time points post-infection

    • Correlation with bacterial replication cycle

    • Synchronization of infection when possible

  • Technical approaches:

    • Selection of detection methods (immunofluorescence, Western blotting, RT-PCR)

    • Validation with multiple methodologies

    • Appropriate quantification strategies

A well-designed experimental timeline should account for both bacterial growth kinetics and host cell responses, similar to the time-course measurements of IFN-β secretion and STAT phosphorylation described in rickettsial research .

What controls should be included when investigating RAF_ORF0501 function?

  • Genetic controls:

    • Wild-type R. africae (positive control)

    • RAF_ORF0501 knockout/knockdown (if technically feasible)

    • RAF_ORF0501 complemented strain (restored function)

    • Strains with mutations in specific RAF_ORF0501 domains

  • Experimental controls:

    • Uninfected host cells

    • Host cells infected with related Rickettsia species

    • Host cells infected with heat-killed R. africae (similar to approaches used in R. rickettsii research )

    • Time-matched controls for all experimental conditions

  • Technical controls:

    • Isotype controls for antibodies

    • Vehicle controls for any treatments

    • Multiple cell lines to ensure results aren't cell-type specific

    • Validation with alternative methodologies

What are recommended protocols for recombinant expression of RAF_ORF0501?

Recombinant expression of RAF_ORF0501 requires carefully optimized protocols to ensure proper protein folding and function:

  • Expression system selection:

    • Prokaryotic systems (E. coli): Suitable for initial characterization but may have folding limitations

    • Eukaryotic systems (insect cells, mammalian cells): Better for complex folding requirements

    • Cell-free systems: Useful for potentially toxic proteins

  • Construct design considerations:

    • Codon optimization for the selected expression system

    • Addition of purification tags (His, GST, MBP) preferably with cleavable linkers

    • Inclusion of appropriate promoters and regulatory elements

    • Consideration of fusion partners to enhance solubility

  • Expression optimization:

    • Temperature optimization (often lower temperatures improve folding)

    • Induction conditions (inducer concentration, timing)

    • Media composition and supplementation

    • Co-expression with chaperones if needed

  • Purification strategy:

    • Initial capture using affinity chromatography

    • Secondary purification via ion exchange or size exclusion

    • Endotoxin removal for proteins intended for functional assays

    • Quality control via SDS-PAGE, Western blot, and activity assays

A sample expression workflow would include cloning RAF_ORF0501 into an expression vector, optimizing conditions in small-scale tests, scaling up production, and performing functional validation of the purified protein.

What cell models are most appropriate for studying RAF_ORF0501 function?

Selecting appropriate cell models is crucial for studying RAF_ORF0501 function in a physiologically relevant context. Based on rickettsial research approaches :

  • Primary endothelial cells:

    • Human dermal microvascular endothelial cells (HDMECs), which have been used successfully in R. rickettsii research

    • Human umbilical vein endothelial cells (HUVECs)

    • Bovine aortic endothelial cells (BAECs)

  • Endothelial cell lines:

    • EA.hy926 (human endothelial hybrid)

    • HMEC-1 (human microvascular endothelial cells)

    • TIME (telomerase-immortalized microvascular endothelial cells)

  • Other relevant cell types:

    • Dendritic cells and macrophages (for immunological studies)

    • Tick cell lines (e.g., ISE6, IDE8) to study vector interactions

    • Hepatocytes (for metabolism studies)

Selection criteria should include:

  • Susceptibility to R. africae infection

  • Expression of relevant host factors

  • Ability to maintain infection for appropriate duration

  • Suitability for intended readouts (microscopy, functional assays)

Research has shown that different Rickettsia strains show variable replication in human dermal microvascular endothelial cells , making this cell type particularly relevant for comparative studies of RAF_ORF0501 function.

How can researchers measure RAF_ORF0501 activity in experimental settings?

Measuring RAF_ORF0501 activity requires appropriate functional assays based on its role in septation:

  • Growth and morphology assessment:

    • Bacterial growth curves with RAF_ORF0501 variants

    • Cell morphology analysis via microscopy

    • Septum formation visualization using membrane dyes or fluorescent D-amino acids

    • Quantification of division frequency and septum positioning

  • Biochemical assays:

    • GTPase activity measurement (if RAF_ORF0501 has GTPase domains)

    • Protein-protein interaction assays (pull-down, SPR, ITC)

    • Polymerization assays (if involved in forming cytoskeletal elements)

    • Peptidoglycan binding assays (if interacting with cell wall components)

  • Host response measurements:

    • Assessment of bacterial loads in infected cells

    • Host cell survival quantification

    • Cytokine production measurement (similar to IFN-β assays used in R. rickettsii studies )

    • Gene expression analysis of host response genes

  • Advanced microscopy approaches:

    • Time-lapse imaging of division process

    • FRAP (Fluorescence Recovery After Photobleaching) to assess protein dynamics

    • Super-resolution microscopy for detailed localization

These methodologies should be applied with appropriate statistical analysis, following principles outlined in experimental design literature3 .

How does RAF_ORF0501 contribute to Rickettsia africae virulence?

Understanding RAF_ORF0501's contribution to R. africae virulence requires integrating molecular function with pathogenesis mechanisms. While specific information on RAF_ORF0501's role in virulence is not directly provided in the search results, we can draw parallels from research on R. rickettsii virulence factors :

  • Potential mechanisms based on septation function:

    • Regulation of bacterial replication rate within host cells

    • Maintenance of optimal bacterial morphology for intracellular survival

    • Coordination of cell division with acquisition of host resources

  • Immune response modulation:

    • Research shows that virulent R. rickettsii strains can modulate IFN-β responses

    • RAF_ORF0501 might similarly influence host immune signaling pathways

    • Potential interference with host cell death pathways (similar to effects on TRAIL expression noted in R. rickettsii studies )

  • Experimental approaches to evaluate virulence contribution:

    • Comparative analysis of wild-type and RAF_ORF0501-mutant strains

    • Assessment of bacterial loads in different cell types

    • Measurement of host cell survival/death

    • Analysis of host immune response markers

Table 1: Hypothetical experimental results comparing RAF_ORF0501 variants

ParameterWild-type R. africaeRAF_ORF0501 mutantComplemented strain
Intracellular growth rateNormalReducedRestored
Bacterial morphologyUniformElongatedUniform
Host cell viabilityMaintainedDecreasedMaintained
IFN-β inductionModerateEnhancedModerate
Virulence in animal modelHighAttenuatedHigh

These approaches would help establish RAF_ORF0501's specific contributions to R. africae virulence, similar to how virulence determinants have been characterized in R. rickettsii .

How do host factors interact with RAF_ORF0501 during infection?

Investigating host factor interactions with RAF_ORF0501 provides insights into pathogenesis mechanisms:

  • Identification of host binding partners:

    • Affinity purification-mass spectrometry using tagged RAF_ORF0501

    • Yeast two-hybrid screening against host cDNA libraries

    • Protein microarray screening

    • Proximity-based labeling approaches (BioID, APEX) in infected cells

  • Validation of interactions:

    • Co-immunoprecipitation from infected cells

    • FRET/BRET to detect interactions in living cells

    • Surface plasmon resonance for binding kinetics

    • Pull-down assays with purified components

  • Functional consequences of interactions:

    • siRNA knockdown of identified host factors

    • CRISPR/Cas9 knockout cell lines

    • Competitive inhibition with peptides or small molecules

    • Host factor mutagenesis to identify critical interaction residues

Rickettsial research has shown that virulence factors can affect host responses such as IFN-β production and expression of genes like TRAIL and IDO . Similar approaches could identify how RAF_ORF0501 might influence host cellular processes through direct protein-protein interactions or indirect effects on host signaling pathways.

What structural elements of RAF_ORF0501 are critical for its function?

Identifying critical structural elements of RAF_ORF0501 requires detailed molecular analysis:

  • Bioinformatic structural prediction:

    • Secondary structure prediction

    • Domain identification through homology searches

    • Identification of conserved motifs across bacterial septation proteins

    • Molecular modeling based on related proteins with known structures

  • Experimental structure determination:

    • X-ray crystallography of purified RAF_ORF0501

    • Cryo-electron microscopy for larger complexes

    • NMR spectroscopy for dynamic regions

    • Hydrogen-deuterium exchange mass spectrometry for conformational analysis

  • Functional mapping through mutagenesis:

    • Alanine scanning of conserved residues

    • Domain deletion/swapping experiments

    • Site-directed mutagenesis of predicted active sites

    • Creation of chimeric proteins with homologs from related species

Critical structural elements might include GTP-binding motifs (if present), protein-protein interaction interfaces, membrane-binding domains, and peptidoglycan interaction regions. Understanding these structural elements would facilitate targeted approaches to disrupting RAF_ORF0501 function as a potential therapeutic strategy.

How does RAF_ORF0501 compare functionally to similar proteins in Rickettsia rickettsii?

Comparing RAF_ORF0501 to homologous proteins in R. rickettsii provides insights into functional conservation and species-specific adaptations. Based on research on R. rickettsii virulence factors :

  • Sequence-based comparison:

    • Alignment of RAF_ORF0501 with R. rickettsii homolog

    • Identification of conserved domains and motifs

    • Analysis of selection pressure on specific residues

    • Phylogenetic analysis across Rickettsia species

  • Functional complementation studies:

    • Expression of RAF_ORF0501 in R. rickettsii strains

    • Rescue of phenotypes in homolog-deficient strains

    • Assessment of chimeric proteins

    • Cross-species protein-protein interaction studies

  • Comparative phenotypic analysis:

    • Growth characteristics in various cell types

    • Cell morphology and division patterns

    • Host response modulation (similar to IFN-β responses described in R. rickettsii research )

    • Virulence in relevant models

Research has shown that virulent R. rickettsii Sheila Smith strain shows different replication patterns and immune response modulation compared to avirulent strains . Similar comparative studies between R. africae and R. rickettsii could reveal whether differences in RAF_ORF0501 contribute to species-specific pathogenesis mechanisms.

What evolutionary insights can be gained from comparing RAF_ORF0501 across different Rickettsia species?

Evolutionary analysis of RAF_ORF0501 across Rickettsia species can provide insights into adaptation and pathogenesis:

  • Phylogenetic analysis:

    • Construction of RAF_ORF0501 phylogenetic tree across Rickettsia species

    • Comparison with species phylogeny to identify potential horizontal gene transfer

    • Dating of evolutionary events using molecular clock approaches

    • Correlation with host and vector evolutionary history

  • Selection pressure analysis:

    • Calculation of dN/dS ratios to identify positively selected residues

    • Identification of conserved vs. variable regions

    • Coevolution analysis with interacting proteins

    • Mapping selection patterns to protein structure

  • Comparative genomic context:

    • Analysis of gene neighborhood conservation

    • Identification of operon structures

    • Assessment of regulatory element conservation

    • Presence/absence patterns across the genus

Gene sequencing approaches for Rickettsia identification, including gltA, htrA, ompA, and ompB genes have been used for taxonomic classification . Similar approaches applied to RAF_ORF0501 could provide understanding of its evolutionary history and relationship to pathogenicity differences among Rickettsia species.

Are there significant differences between RAF_ORF0501 and analogous proteins in non-pathogenic Rickettsia?

Comparing RAF_ORF0501 with homologs in non-pathogenic Rickettsia species may reveal adaptations related to pathogenesis:

  • Structural differences assessment:

    • Comparative protein modeling of RAF_ORF0501 and non-pathogenic homologs

    • Identification of pathogen-specific structural elements

    • Analysis of surface properties and interaction interfaces

    • Experimental structure determination for key homologs

  • Functional comparison approaches:

    • Growth complementation studies in various backgrounds

    • Localization patterns in pathogenic vs. non-pathogenic species

    • Protein-protein interaction network differences

    • Host response to heterologously expressed proteins

Research has shown that non-pathogenic R. montanensis exhibits different growth patterns compared to virulent R. rickettsii strains and doesn't induce IFN-β production . Similar comparative studies with R. africae, focusing on RAF_ORF0501, could reveal whether this protein contributes to pathogenicity-specific traits.

What are the implications of RAF_ORF0501 in developing targeted therapies against African tick-bite fever?

Exploring RAF_ORF0501 as a potential therapeutic target requires understanding its essentiality and druggability:

  • Target validation:

    • Essentiality assessment through genetic approaches

    • Evaluation of conservation across Rickettsia strains

    • Absence of close homologs in human proteome

    • Accessibility to inhibitors (cellular location, structural features)

  • Drug discovery approaches:

    • High-throughput screening against purified RAF_ORF0501

    • Structure-based drug design if crystal structure is available

    • Fragment-based screening

    • Repurposing of existing septation protein inhibitors

  • Therapeutic modalities:

    • Small molecule inhibitors

    • Peptide-based inhibitors

    • RNA-based approaches (if delivery challenges can be overcome)

    • Protein-protein interaction disruptors

  • Evaluation in disease models:

    • In vitro efficacy in infected cell models

    • Ex vivo tissue models

    • Animal models of R. africae infection

    • Assessment of resistance development

Potential advantages of targeting RAF_ORF0501 include its likely essentiality for bacterial survival and specificity to bacterial systems (reducing host toxicity). Challenges include delivery of inhibitors to intracellular bacteria and potential redundancy in septation mechanisms. A therapeutic strategy might involve combining RAF_ORF0501 inhibitors with traditional antibiotics to enhance efficacy and reduce resistance development.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.