Recombinant Rickettsia akari Probable intracellular septation protein A (A1C_02940)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate your preference when placing the order. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. The shelf life of lyophilized forms is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us and we will prioritize the development of the specified tag.
Synonyms
yciB; A1C_02940; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Rickettsia akari (strain Hartford)
Target Names
A1C_02940
Target Protein Sequence
MLKLLSEIGPVIAFFAGFFYGGGIQNATLYMLITSVICITLCYIIDKKVSKLSIISTTVL LVSGSITLISGDSMYIKIKPTILYVIFGIIFLMSGIRKTPFIKYALESIVRLKEESWITL SYRTAAFFFFMAVVNEIVWRNFSDETWVKFKVFGIIPITFIFIVLQLPLLLKNKLPDSKI
Uniprot No.

Target Background

Function
This protein plays a crucial role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links
Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rickettsia akari Probable intracellular septation protein A (A1C_02940)?

A1C_02940 is a protein encoded by the Rickettsia akari genome (strain Hartford) that functions in bacterial cell division, specifically in intracellular septation processes. It belongs to the YciB protein family and consists of 180 amino acids with a molecular mass of 20.42 kDa . Like other rickettsial proteins, A1C_02940 likely evolved through genome reduction, a characteristic adaptation to the obligate intracellular lifestyle of these bacteria .

How does A1C_02940 function in bacterial cell division?

A1C_02940 likely participates in the septation process during R. akari cell division, possibly functioning similarly to other septation proteins that coordinate divisome assembly. Current understanding of bacterial septation mechanisms suggests that A1C_02940 may interact with the peptidoglycan synthesis machinery and cytoskeletal elements to facilitate proper septum formation . The protein may function analogously to septation regulators like MztA, which has been observed in other bacterial systems to mediate septation through interaction with proteins involved in the Septation Initiation Network (SIN) .

What expression systems are recommended for recombinant production of A1C_02940?

For recombinant expression of A1C_02940, researchers should consider:

  • E. coli-based systems: BL21(DE3) or C41/C43 strains optimized for membrane protein expression

  • Expression tags: N-terminal His6 or MBP fusion tags to enhance solubility while minimizing interference with transmembrane domains

  • Induction conditions: Low temperature (16-18°C) with reduced IPTG concentration (0.1-0.5 mM) to prevent inclusion body formation

The heterologous expression approach should be modeled after successful methods used for other rickettsial proteins. For example, the 44 kDa uncharacterized protein (A8GP63) was successfully expressed recombinantly for immunological studies .

What purification strategies are optimal for membrane-associated proteins like A1C_02940?

Purification of A1C_02940 presents challenges due to its predicted membrane association. A recommended purification protocol includes:

StepMethodBuffer CompositionNotes
1Cell lysis50 mM Tris-HCl pH 8.0, 150 mM NaCl, 1% DDMGentle detergent solubilization
2Initial captureIMAC with Ni-NTA resinFor His-tagged constructs
3Buffer exchangeSize exclusion chromatography50 mM Tris-HCl pH 8.0, 150 mM NaCl, 0.1% DDM
4Quality controlSDS-PAGE and Western blottingVerify purity and identity

Researchers should be aware that membrane proteins often require optimization of detergent types and concentrations for effective solubilization without denaturation .

How can researchers verify the subcellular localization of A1C_02940?

To determine the precise subcellular localization of A1C_02940 within R. akari, researchers should employ a multi-faceted approach:

  • Fluorescence microscopy: Generate GFP-fusion constructs of A1C_02940 for live-cell imaging, using approaches similar to those employed for localizing MobA in septation studies .

  • Immunofluorescence: Develop specific antibodies against A1C_02940 for fixed-cell immunolocalization studies, using protocols established for other rickettsial proteins.

  • Fractionation studies: Separate membrane and cytosolic fractions through ultracentrifugation, followed by Western blotting to detect A1C_02940.

  • Electron microscopy: Employ immunogold labeling with anti-A1C_02940 antibodies for high-resolution localization at the septation site.

The methods should include appropriate controls, such as known septation proteins, to validate the results .

What genetic approaches can be used to study A1C_02940 function?

Genetic manipulation of obligate intracellular pathogens presents significant challenges. For functional analysis of A1C_02940, researchers should consider:

  • Conditional expression systems: Implement inducible promoters to control A1C_02940 expression levels and observe phenotypic effects on septation and cell division.

  • Complementation studies: Express A1C_02940 in related bacterial species with septation defects to assess functional conservation.

  • Site-directed mutagenesis: Generate point mutations in conserved residues to identify functionally important domains.

  • Heterologous expression: Express A1C_02940 in surrogate bacterial hosts that are more amenable to genetic manipulation but have septation machinery similar to Rickettsia.

Similar approaches have been used successfully to study proteins in the septation initiation network in other bacterial systems .

How can researchers identify potential protein interaction partners of A1C_02940?

To elucidate the interactome of A1C_02940, the following methodologies are recommended:

  • Bacterial two-hybrid screening: Use constructs expressing A1C_02940 fused to one domain of a split reporter protein to screen against a library of R. akari proteins.

  • Co-immunoprecipitation: Express tagged versions of A1C_02940 and use antibodies to pull down protein complexes for identification by mass spectrometry.

  • Proximity-dependent biotin labeling: Employ BioID or APEX2 fusion constructs to identify proteins in close proximity to A1C_02940 in living cells.

  • Crosslinking mass spectrometry: Use chemical crosslinkers to stabilize transient protein-protein interactions followed by mass spectrometric analysis.

These methods could reveal interactions with other cell division proteins such as those in the SIN pathway, which is known to be involved in septation .

What is known about the regulation of A1C_02940 during the Rickettsia life cycle?

While specific information about A1C_02940 regulation is limited in the available literature, insights can be drawn from related septation proteins. The expression of septation proteins is typically cell cycle-dependent, peaking during the division phase. Proteomic analysis of Rickettsia akari has identified numerous proteins involved in translation, post-translational modifications, and cell wall development, suggesting complex regulatory networks .

By analogy with other septation systems, A1C_02940 expression may be regulated by:

  • Cell cycle-dependent transcriptional control

  • Post-translational modifications, particularly phosphorylation

  • Protein-protein interactions that influence stability and activity

Phosphorylation/dephosphorylation reactions have been shown to play critical roles in regulating septation proteins in other bacterial systems, with protein phosphatases coordinating these regulatory pathways .

How might A1C_02940 contribute to Rickettsia akari pathogenesis?

As a protein involved in bacterial cell division, A1C_02940 is essential for R. akari proliferation within host cells. While not directly involved in host-pathogen interactions like surface-exposed proteins (OmpB, OmpA, Sca2), A1C_02940's role in septation makes it indirectly crucial for pathogenesis by enabling bacterial replication .

Disruption of A1C_02940 function could potentially:

  • Impair bacterial cell division leading to elongated cells

  • Reduce bacterial burden due to decreased proliferation rates

  • Attenuate infection due to growth defects

This makes A1C_02940 a potential target for therapeutic interventions that seek to inhibit rickettsial replication rather than bacterial attachment or invasion mechanisms .

Could A1C_02940 serve as a diagnostic marker for rickettsialpox?

While A1C_02940 has not been specifically identified as a diagnostic marker for rickettsialpox, proteomics studies of R. akari have identified several immunoreactive proteins that could improve disease recognition. The 44 kDa uncharacterized protein (A8GP63) has demonstrated unique detection capability for distinguishing rickettsialpox from other rickettsial infections .

To assess A1C_02940's potential as a diagnostic marker, researchers should:

  • Perform serological screening using recombinant A1C_02940 against sera from:

    • Confirmed rickettsialpox patients

    • Patients with other rickettsial diseases

    • Healthy controls

  • Evaluate sensitivity and specificity compared to established markers like the 44 kDa protein (A8GP63)

  • Develop and validate immunoassay formats (ELISA, lateral flow) for clinical application

The specificity of A1C_02940 to R. akari compared to other Rickettsia species would be a critical determinant of its diagnostic value .

What approaches could be used to assess A1C_02940 as a therapeutic target?

Evaluating A1C_02940 as a potential therapeutic target requires a multifaceted approach:

  • Target validation studies:

    • Generate conditional knockdowns or dominant-negative mutants of A1C_02940

    • Quantify effects on bacterial growth, morphology, and virulence

  • High-throughput screening:

    • Develop assays to measure A1C_02940 activity or protein-protein interactions

    • Screen chemical libraries for inhibitory compounds

  • Structure-based drug design:

    • Determine the 3D structure of A1C_02940 through X-ray crystallography or cryo-EM

    • Identify potential binding pockets for small molecule inhibitors

  • In vitro and in vivo efficacy testing:

    • Evaluate promising compounds in cell culture infection models

    • Test lead compounds in animal models of rickettsialpox

Given the importance of bacterial cell division, inhibitors of A1C_02940 could potentially have broad-spectrum activity against multiple Rickettsia species .

How does A1C_02940 compare to septation proteins in other bacterial species?

A1C_02940 belongs to the YciB family of proteins, which are found across various bacterial species. Comparative analysis reveals both similarities and differences with other septation systems:

  • Conserved features: Like other septation proteins, A1C_02940 likely participates in the coordination of cell wall synthesis at the division site.

  • Evolutionary adaptations: As part of a reduced genome resulting from adaptation to an intracellular lifestyle, A1C_02940 may have evolved specialized functions compared to homologs in free-living bacteria .

  • Functional homology: It may share functional similarities with septation regulators like MztA, which has been shown to mediate septation through interaction with the Septation Initiation Network in other bacterial systems .

Interestingly, the mechanisms of septation in Rickettsia appear distinct from better-studied bacterial pathogens, underscoring the potential for discovering novel biology through the study of rickettsial proteins .

What is the conservation of A1C_02940 across different Rickettsia species?

The conservation of A1C_02940 across Rickettsia species reflects the essential nature of cell division machinery. Analysis suggests:

  • High conservation: Core cell division proteins tend to be highly conserved across the Rickettsia genus due to their essential function.

  • Sequence divergence: Some variation in sequence may exist, particularly in species adapted to different arthropod vectors or mammalian hosts.

  • Functional conservation: Despite sequence differences, the fundamental role in septation is likely preserved across species.

This conservation pattern makes A1C_02940 a potential broad-spectrum target for anti-rickettsial interventions, though specific sequence variations might influence protein-protein interactions and regulation in different Rickettsia species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.