Recombinant Rickettsia akari Protein translocase subunit SecF (secF) is a recombinant protein derived from Rickettsia akari, a bacterium responsible for causing Rickettsialpox. This protein is part of the Sec translocase complex, which plays a crucial role in the transport of proteins across bacterial membranes. The SecF subunit is essential for the proper functioning of this complex, facilitating the movement of proteins from the cytoplasm to the periplasm or outer membrane.
The SecF subunit is a component of the Sec translocase complex, which includes SecA, SecY, SecE, SecG, and SecD. This complex is responsible for the translocation of proteins across the bacterial inner membrane. SecF, along with SecD, forms a subcomplex that helps in the regulation of protein secretion by interacting with the SecYEG channel. This interaction ensures efficient protein translocation and maintains membrane integrity .
Sequence and Structure: The recombinant SecF protein from Rickettsia akari has a specific amino acid sequence (e.g., MQIYPLRLLPNKIDFDFMNFKAVSYSFSIILSLISFIWIGIYKFNFGIDFAGGIVIEVRL DQAPDLPKMRGVLGELGIGEVVLQNFGSERDLSIRFGISSEENLMKNIELIKASLQSSFP YKFEYRKVDFVGPQVGRQLIEAGAMAmLSSFLAIMVYIWVRFEWYFGLGILIALVHDVIL ALGFMSITKLDFNLSTIAAVLTIIGYSVNDSVVIYDRIRENLRKYHKKNITEIINLSINE TLSRTILTVITTLLANLALmLFGGEAIRSFSVLVFFGIIAGTYSSIFISAPILTMFANRK FNNKVIER) and is approximately 308 amino acids long .
Production and Storage: This recombinant protein is produced in a suitable host system and is available in quantities such as 50 µg. It is stored in a Tris-based buffer with 50% glycerol at -20°C to maintain stability .
| Characteristic | Description |
|---|---|
| Species | Rickettsia akari (strain Hartford) |
| Protein Length | Approximately 308 amino acids |
| Sequence | Specific amino acid sequence (e.g., MQIYPLRLLPNKIDFDFMNFKAVSYSFSIILSLISFIWIGIYKFNFGIDFAGGIVIEVRL DQAPDLPKMRGVLGELGIGEVVLQNFGSERDLSIRFGISSEENLMKNIELIKASLQSSFP YKFEYRKVDFVGPQVGRQLIEAGAMAmLSSFLAIMVYIWVRFEWYFGLGILIALVHDVIL ALGFMSITKLDFNLSTIAAVLTIIGYSVNDSVVIYDRIRENLRKYHKKNITEIINLSINE TLSRTILTVITTLLANLALmLFGGEAIRSFSVLVFFGIIAGTYSSIFISAPILTMFANRK FNNKVIER) |
| Storage Conditions | Tris-based buffer, 50% glycerol, stored at -20°C |
| Quantity Available | 50 µg (other quantities available upon request) |
Recombinant Rickettsia akari Protein translocase subunit SecF (SecF) is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA.
KEGG: rak:A1C_00855
STRING: 293614.A1C_00855
The Protein Translocase Subunit SecF (secF) in Rickettsia akari is a component of the Sec translocon system, which serves as the major route for bacterial protein secretion from the cytoplasm to the periplasm or extracellular environment. This protein plays a crucial role in the translocation of various proteins across the bacterial membrane, facilitating the bacterium's adaptation to different host environments (both mammalian and arthropod) . As an obligate intracellular pathogen, R. akari requires efficient protein translocation mechanisms to establish infection and maintain its life cycle. The SecF protein (UniProt ID: A8GM76) consists of 308 amino acids and functions as part of the SecYEG-SecDF complex that creates a channel through which proteins are transported .
The R. akari SecF protein exhibits species-specific variations when compared to SecF proteins in other bacteria. For example, the R. akari SecF (308 amino acids) is shorter than the M. leprae SecF (471 amino acids) . This difference in length suggests potential functional adaptations specific to the intracellular lifestyle of Rickettsia species. Additionally, sequence analysis reveals conserved domains essential for the function of the Sec translocon system, but with variations that may reflect adaptation to the unique intracellular niche of R. akari. These adaptations may contribute to the pathogen's ability to survive within both mammalian and arthropod host cells, a characteristic feature of rickettsial species .
For optimal preservation of recombinant R. akari SecF protein activity:
| Parameter | Recommended Condition | Notes |
|---|---|---|
| Storage Temperature | -20°C to -80°C | For extended storage, -80°C is preferable |
| Working Storage | 4°C | For up to one week |
| Physical Form | Lyophilized powder | Prior to reconstitution |
| Buffer Composition | Tris/PBS-based buffer with 6% Trehalose, pH 8.0 | For stability |
| Glycerol Concentration | 5-50% (final concentration) | 50% is standard for long-term storage |
| Freeze-Thaw Cycles | Minimize | Aliquot to avoid repeated cycles |
Preparation protocol: Before opening, briefly centrifuge the vial to bring contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, add glycerol to a final concentration of 5-50% and aliquot to avoid repeated freeze-thaw cycles, which can significantly decrease protein activity .
The most commonly used and effective expression system for producing recombinant R. akari SecF protein is Escherichia coli. This heterologous expression system offers several advantages:
High yield of recombinant protein
Relatively simple genetic manipulation
Cost-effectiveness
Well-established protocols for induction and purification
The commercially available recombinant R. akari SecF protein (UniProt ID: A8GM76) is produced in E. coli with an N-terminal His tag to facilitate purification. This approach allows for efficient isolation of the protein using affinity chromatography methods. When designing expression constructs, researchers should consider codon optimization for E. coli to enhance expression levels, as rickettsial codon usage differs from that of E. coli .
A multi-step purification approach is recommended to obtain high-purity recombinant R. akari SecF protein with preserved biological activity:
| Purification Step | Method | Purpose |
|---|---|---|
| Initial Capture | Ni-NTA Affinity Chromatography | Leverages His-tag for initial separation |
| Intermediate Purification | Ion Exchange Chromatography | Removes contaminants with different charge properties |
| Polishing | Size Exclusion Chromatography | Achieves final purification based on molecular size |
| Quality Control | SDS-PAGE | Confirms >90% purity |
Critical considerations for maintaining biological activity include:
Use of protease inhibitors during initial cell lysis
Maintaining appropriate pH (typically 7.5-8.0) throughout purification
Including stabilizing agents like glycerol in buffers
Conducting purification at 4°C when possible to minimize protein degradation
Avoiding harsh elution conditions that might denature the protein
After purification, aliquot the protein and store with 50% glycerol at -80°C to preserve activity for extended periods .
The SecF protein, as a component of the Sec translocon system, plays a critical role in rickettsial pathogenesis through several mechanisms:
Virulence factor translocation: The Sec system facilitates the secretion of numerous virulence factors that are essential for host cell attachment, invasion, and intracellular survival. In rickettsial species, these include autotransporters and other extracytoplasmic proteins that mediate host-pathogen interactions .
Membrane protein integration: SecF helps in the proper insertion of membrane proteins that function as adhesins, invasins, and immune evasion factors. For example, in R. rickettsii, surface-exposed autotransporters are known virulence determinants that require the Sec system for proper localization .
Adaptation to host environments: The SecF protein enables rickettsiae to adapt to both mammalian and arthropod host environments by facilitating the secretion of host-specific adaptation factors. This dual adaptation is critical for the vector-borne transmission cycle of rickettsiae .
Research with R. rickettsii has demonstrated that mutations affecting protein translocation can significantly attenuate virulence. For instance, the Iowa strain of R. rickettsii, which fails to properly process certain autotransporters, shows reduced virulence compared to the virulent Sheila Smith strain. Experimental reconstitution of proper protein processing partially restored virulence, highlighting the importance of protein translocation systems in rickettsial pathogenesis .
Several sophisticated assays can be employed to evaluate the functionality of recombinant R. akari SecF protein:
| Assay Type | Methodology | Data Generated |
|---|---|---|
| Membrane Reconstitution Assays | Reconstitution of SecF into liposomes with other Sec components | Measures protein translocation efficiency across artificial membranes |
| ATPase Activity Assays | Quantification of ATP hydrolysis in the presence of SecF and SecD | Determines energy coupling during translocation |
| Fluorescence Resonance Energy Transfer (FRET) | Labeling SecF and interaction partners with fluorescent probes | Visualizes protein-protein interactions in real-time |
| Surface Plasmon Resonance | Immobilization of SecF on sensor chips | Measures binding kinetics with other Sec components or substrate proteins |
| Cross-linking Studies | Chemical cross-linking followed by mass spectrometry | Identifies interaction sites between SecF and other proteins |
For functional validation in a more physiological context, complementation studies can be performed using E. coli strains with temperature-sensitive mutations in secF. Expression of functional R. akari SecF should restore protein secretion at non-permissive temperatures. Additionally, in vitro translocation assays using purified components of the Sec system can directly assess the contribution of SecF to protein translocation efficiency .
The structure-function relationship of SecF in Rickettsia involves several key domains that work coordinately during protein translocation:
Transmembrane domains: Multiple transmembrane helices anchor SecF within the bacterial membrane and form part of the translocation channel. These domains contain conserved residues that interact with the translocating polypeptide chain.
Periplasmic loops: Large periplasmic domains of SecF interact with substrate proteins as they emerge from the SecYEG channel. These domains undergo conformational changes that help "pull" the translocating protein through the membrane.
Cytoplasmic domains: These regions interact with other components of the translocation machinery, including SecD and YajC, which together form a complex that enhances the efficiency of protein translocation.
The coordinated action of these domains creates a dynamic system that can adapt to various substrate proteins. The SecDF complex is thought to use the proton motive force to drive protein translocation, functioning as a molecular motor that works in concert with the SecYEG translocon to move proteins across the membrane. Mutations in any of these functional domains could potentially disrupt protein translocation, affecting bacterial viability and virulence .
Researchers frequently encounter several challenges when working with recombinant membrane proteins like SecF:
| Challenge | Cause | Solution Strategy |
|---|---|---|
| Poor expression yields | Toxicity to host cells; protein misfolding | Use tightly regulated expression systems; lower induction temperature (16-20°C); co-express chaperones |
| Protein aggregation | Hydrophobic transmembrane domains; improper folding | Add detergents during purification; use solubilization agents; optimize buffer conditions |
| Loss of native conformation | Denaturation during purification | Use milder detergents (DDM, LMNG); include lipids during purification; maintain cold temperature throughout |
| Instability after purification | Protein degradation; aggregation | Add protease inhibitors; prepare fresh before use; maintain appropriate pH and ionic strength |
| Difficult reconstitution | Incomplete incorporation into liposomes | Optimize lipid composition; use gradual detergent removal methods; verify incorporation by density gradient centrifugation |
When troubleshooting recombinant SecF protein work, systematic optimization of expression conditions is essential. For instance, screening multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3)) that are specialized for membrane protein expression can significantly improve yields. Additionally, fusion partners such as MBP (Maltose Binding Protein) or SUMO can enhance solubility and stability .
Validating the structural integrity of purified recombinant R. akari SecF protein requires multiple complementary approaches:
Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure content (α-helices, β-sheets) and can be used to confirm proper folding. For membrane proteins like SecF, which contain significant α-helical content, CD spectra should show characteristic minima at 208 and 222 nm.
Thermal Shift Assays: Measures protein stability by monitoring unfolding as temperature increases. Well-folded proteins typically show cooperative unfolding transitions.
Limited Proteolysis: Properly folded proteins show resistance to digestion at specific sites. The digestion pattern can be analyzed by SDS-PAGE and compared to predicted patterns.
Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Determines the oligomeric state and homogeneity of the purified protein.
Tryptophan Fluorescence Spectroscopy: Monitors the local environment of tryptophan residues, which can indicate proper tertiary structure formation.
For membrane proteins like SecF, additional validation can include reconstitution into nanodiscs or liposomes followed by negative-stain electron microscopy to visualize the protein in a membrane-like environment. This approach can confirm both proper folding and membrane integration .
Current research on rickettsial SecF is expanding our understanding of bacterial protein secretion in several key areas:
Adaptation of secretion systems in obligate intracellular pathogens: Studies on R. akari SecF provide insights into how the Sec translocon has evolved in organisms that are completely dependent on host cells. This research reveals adaptations that optimize protein secretion within the unique intracellular environment .
Minimal secretion machinery: Rickettsia species have undergone genome reduction during their evolution as obligate intracellular parasites. Analysis of their Sec systems helps define the minimal essential components required for functional protein secretion, which has implications for synthetic biology applications .
Host-pathogen interface dynamics: Research on SecF-dependent extracytoplasmic proteins in Rickettsia is uncovering how these bacteria interact with host cells through secreted effectors. This work is revealing new mechanisms of bacterial manipulation of host cellular processes .
Comparative studies across rickettsial species: Examination of SecF across different Rickettsia species (e.g., R. akari, R. rickettsii) is highlighting how variations in protein secretion systems may contribute to differences in tissue tropism, pathogenicity, and host range .
Future research directions will likely focus on in situ structural studies of the entire Sec translocon complex in rickettsial species, potentially using cryo-electron microscopy to visualize the translocation process in native-like environments .
The essential nature of SecF in rickettsial biology makes it an attractive target for antimicrobial development:
| Therapeutic Approach | Mechanism | Advantage |
|---|---|---|
| Small molecule inhibitors | Direct binding to SecF to disrupt function | High specificity; potential for broad-spectrum activity against multiple rickettsial species |
| Peptide-based inhibitors | Competitive inhibition of substrate binding | May offer higher selectivity for bacterial vs. host proteins |
| Combination therapies | Targeting SecF along with other essential systems | Reduced resistance development; synergistic effects |
| Attenuated vaccine development | Strains with modified SecF function | Controlled attenuation while maintaining immunogenicity |
Research with R. rickettsii has demonstrated that strains with compromised protein processing show attenuated virulence, suggesting that SecF inhibition could effectively reduce pathogenicity. For example, the highly passaged Iowa strain of R. rickettsii, which fails to properly process certain autotransporters, shows significantly reduced virulence compared to wild-type strains .
Challenges in this approach include ensuring specificity for bacterial SecF while avoiding cross-reactivity with human protein translocation systems. Additionally, the intracellular lifestyle of rickettsiae presents delivery challenges for potential inhibitors. Future therapeutic strategies may involve nanoparticle-based delivery systems designed to target infected cells and release SecF inhibitors intracellularly .
Advanced structural biology techniques are poised to revolutionize our understanding of rickettsial SecF:
Cryo-electron microscopy (cryo-EM): This technique can now achieve near-atomic resolution of membrane protein complexes in their native-like environments. For rickettsial SecF, cryo-EM could reveal:
The complete architecture of the SecDFYajC-SecYEG supercomplex
Conformational changes during different stages of protein translocation
Interaction interfaces between SecF and substrate proteins
Structural adaptations unique to rickettsial species
AlphaFold and other AI-based structure prediction tools: These computational approaches can predict protein structures with unprecedented accuracy, offering advantages such as:
Generation of structural models for rickettsial SecF variants that are difficult to express and purify
Prediction of protein-protein interaction interfaces between SecF and other translocon components
Identification of potential small molecule binding sites for drug development
Comparison of SecF structures across different rickettsial species to identify conserved functional domains
Integrative structural biology approaches: Combining multiple techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS), cross-linking mass spectrometry (XL-MS), and single-particle cryo-EM can provide comprehensive insights into both structure and dynamics of the SecF protein and its interactions.
These advanced approaches will likely uncover the molecular mechanisms by which rickettsial SecF has adapted to the unique challenges of protein secretion in an obligate intracellular pathogen, potentially revealing novel targets for therapeutic intervention .