Recombinant Rickettsia akari Protein translocase subunit SecF (secF)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rickettsia akari Protein Translocase Subunit SecF (secF)

Recombinant Rickettsia akari Protein translocase subunit SecF (secF) is a recombinant protein derived from Rickettsia akari, a bacterium responsible for causing Rickettsialpox. This protein is part of the Sec translocase complex, which plays a crucial role in the transport of proteins across bacterial membranes. The SecF subunit is essential for the proper functioning of this complex, facilitating the movement of proteins from the cytoplasm to the periplasm or outer membrane.

Function of SecF in Bacterial Protein Translocation

The SecF subunit is a component of the Sec translocase complex, which includes SecA, SecY, SecE, SecG, and SecD. This complex is responsible for the translocation of proteins across the bacterial inner membrane. SecF, along with SecD, forms a subcomplex that helps in the regulation of protein secretion by interacting with the SecYEG channel. This interaction ensures efficient protein translocation and maintains membrane integrity .

Characteristics of Recombinant Rickettsia akari SecF

  • Sequence and Structure: The recombinant SecF protein from Rickettsia akari has a specific amino acid sequence (e.g., MQIYPLRLLPNKIDFDFMNFKAVSYSFSIILSLISFIWIGIYKFNFGIDFAGGIVIEVRL DQAPDLPKMRGVLGELGIGEVVLQNFGSERDLSIRFGISSEENLMKNIELIKASLQSSFP YKFEYRKVDFVGPQVGRQLIEAGAMAmLSSFLAIMVYIWVRFEWYFGLGILIALVHDVIL ALGFMSITKLDFNLSTIAAVLTIIGYSVNDSVVIYDRIRENLRKYHKKNITEIINLSINE TLSRTILTVITTLLANLALmLFGGEAIRSFSVLVFFGIIAGTYSSIFISAPILTMFANRK FNNKVIER) and is approximately 308 amino acids long .

  • Production and Storage: This recombinant protein is produced in a suitable host system and is available in quantities such as 50 µg. It is stored in a Tris-based buffer with 50% glycerol at -20°C to maintain stability .

Data Table: Characteristics of Recombinant Rickettsia akari SecF

CharacteristicDescription
SpeciesRickettsia akari (strain Hartford)
Protein LengthApproximately 308 amino acids
SequenceSpecific amino acid sequence (e.g., MQIYPLRLLPNKIDFDFMNFKAVSYSFSIILSLISFIWIGIYKFNFGIDFAGGIVIEVRL DQAPDLPKMRGVLGELGIGEVVLQNFGSERDLSIRFGISSEENLMKNIELIKASLQSSFP YKFEYRKVDFVGPQVGRQLIEAGAMAmLSSFLAIMVYIWVRFEWYFGLGILIALVHDVIL ALGFMSITKLDFNLSTIAAVLTIIGYSVNDSVVIYDRIRENLRKYHKKNITEIINLSINE TLSRTILTVITTLLANLALmLFGGEAIRSFSVLVFFGIIAGTYSSIFISAPILTMFANRK FNNKVIER)
Storage ConditionsTris-based buffer, 50% glycerol, stored at -20°C
Quantity Available50 µg (other quantities available upon request)

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
Note: While the tag type is determined during production, please specify your desired tag type for preferential development.
Synonyms
secF; A1C_00855; Protein translocase subunit SecF
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-308
Protein Length
full length protein
Species
Rickettsia akari (strain Hartford)
Target Names
secF
Target Protein Sequence
MQIYPLRLLPNKIDFDFMNFKAVSYSFSIILSLISFIWIGIYKFNFGIDFAGGIVIEVRL DQAPDLPKMRGVLGELGIGEVVLQNFGSERDLSIRFGISSEENLMKNIELIKASLQSSFP YKFEYRKVDFVGPQVGRQLIEAGAMAMLSSFLAIMVYIWVRFEWYFGLGILIALVHDVIL ALGFMSITKLDFNLSTIAAVLTIIGYSVNDSVVIYDRIRENLRKYHKKNITEIINLSINE TLSRTILTVITTLLANLALMLFGGEAIRSFSVLVFFGIIAGTYSSIFISAPILTMFANRK FNNKVIER
Uniprot No.

Target Background

Function

Recombinant Rickettsia akari Protein translocase subunit SecF (SecF) is a component of the Sec protein translocase complex. It interacts with the SecYEG preprotein conducting channel. SecDF utilizes the proton motive force (PMF) to complete protein translocation following the ATP-dependent function of SecA.

Database Links
Protein Families
SecD/SecF family, SecF subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the SecF protein in Rickettsia akari and what is its primary function?

The Protein Translocase Subunit SecF (secF) in Rickettsia akari is a component of the Sec translocon system, which serves as the major route for bacterial protein secretion from the cytoplasm to the periplasm or extracellular environment. This protein plays a crucial role in the translocation of various proteins across the bacterial membrane, facilitating the bacterium's adaptation to different host environments (both mammalian and arthropod) . As an obligate intracellular pathogen, R. akari requires efficient protein translocation mechanisms to establish infection and maintain its life cycle. The SecF protein (UniProt ID: A8GM76) consists of 308 amino acids and functions as part of the SecYEG-SecDF complex that creates a channel through which proteins are transported .

How does R. akari SecF differ from SecF proteins in other bacterial species?

The R. akari SecF protein exhibits species-specific variations when compared to SecF proteins in other bacteria. For example, the R. akari SecF (308 amino acids) is shorter than the M. leprae SecF (471 amino acids) . This difference in length suggests potential functional adaptations specific to the intracellular lifestyle of Rickettsia species. Additionally, sequence analysis reveals conserved domains essential for the function of the Sec translocon system, but with variations that may reflect adaptation to the unique intracellular niche of R. akari. These adaptations may contribute to the pathogen's ability to survive within both mammalian and arthropod host cells, a characteristic feature of rickettsial species .

What are the optimal storage and handling conditions for recombinant R. akari SecF protein?

For optimal preservation of recombinant R. akari SecF protein activity:

ParameterRecommended ConditionNotes
Storage Temperature-20°C to -80°CFor extended storage, -80°C is preferable
Working Storage4°CFor up to one week
Physical FormLyophilized powderPrior to reconstitution
Buffer CompositionTris/PBS-based buffer with 6% Trehalose, pH 8.0For stability
Glycerol Concentration5-50% (final concentration)50% is standard for long-term storage
Freeze-Thaw CyclesMinimizeAliquot to avoid repeated cycles

Preparation protocol: Before opening, briefly centrifuge the vial to bring contents to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, add glycerol to a final concentration of 5-50% and aliquot to avoid repeated freeze-thaw cycles, which can significantly decrease protein activity .

What expression systems are most effective for producing functional recombinant R. akari SecF protein?

The most commonly used and effective expression system for producing recombinant R. akari SecF protein is Escherichia coli. This heterologous expression system offers several advantages:

  • High yield of recombinant protein

  • Relatively simple genetic manipulation

  • Cost-effectiveness

  • Well-established protocols for induction and purification

The commercially available recombinant R. akari SecF protein (UniProt ID: A8GM76) is produced in E. coli with an N-terminal His tag to facilitate purification. This approach allows for efficient isolation of the protein using affinity chromatography methods. When designing expression constructs, researchers should consider codon optimization for E. coli to enhance expression levels, as rickettsial codon usage differs from that of E. coli .

What purification strategies yield the highest purity and biological activity for recombinant R. akari SecF?

A multi-step purification approach is recommended to obtain high-purity recombinant R. akari SecF protein with preserved biological activity:

Purification StepMethodPurpose
Initial CaptureNi-NTA Affinity ChromatographyLeverages His-tag for initial separation
Intermediate PurificationIon Exchange ChromatographyRemoves contaminants with different charge properties
PolishingSize Exclusion ChromatographyAchieves final purification based on molecular size
Quality ControlSDS-PAGEConfirms >90% purity

Critical considerations for maintaining biological activity include:

  • Use of protease inhibitors during initial cell lysis

  • Maintaining appropriate pH (typically 7.5-8.0) throughout purification

  • Including stabilizing agents like glycerol in buffers

  • Conducting purification at 4°C when possible to minimize protein degradation

  • Avoiding harsh elution conditions that might denature the protein

After purification, aliquot the protein and store with 50% glycerol at -80°C to preserve activity for extended periods .

How does the SecF protein contribute to rickettsial pathogenesis and host cell interaction?

The SecF protein, as a component of the Sec translocon system, plays a critical role in rickettsial pathogenesis through several mechanisms:

  • Virulence factor translocation: The Sec system facilitates the secretion of numerous virulence factors that are essential for host cell attachment, invasion, and intracellular survival. In rickettsial species, these include autotransporters and other extracytoplasmic proteins that mediate host-pathogen interactions .

  • Membrane protein integration: SecF helps in the proper insertion of membrane proteins that function as adhesins, invasins, and immune evasion factors. For example, in R. rickettsii, surface-exposed autotransporters are known virulence determinants that require the Sec system for proper localization .

  • Adaptation to host environments: The SecF protein enables rickettsiae to adapt to both mammalian and arthropod host environments by facilitating the secretion of host-specific adaptation factors. This dual adaptation is critical for the vector-borne transmission cycle of rickettsiae .

Research with R. rickettsii has demonstrated that mutations affecting protein translocation can significantly attenuate virulence. For instance, the Iowa strain of R. rickettsii, which fails to properly process certain autotransporters, shows reduced virulence compared to the virulent Sheila Smith strain. Experimental reconstitution of proper protein processing partially restored virulence, highlighting the importance of protein translocation systems in rickettsial pathogenesis .

What functional assays can be used to assess the activity of recombinant R. akari SecF protein in vitro?

Several sophisticated assays can be employed to evaluate the functionality of recombinant R. akari SecF protein:

Assay TypeMethodologyData Generated
Membrane Reconstitution AssaysReconstitution of SecF into liposomes with other Sec componentsMeasures protein translocation efficiency across artificial membranes
ATPase Activity AssaysQuantification of ATP hydrolysis in the presence of SecF and SecDDetermines energy coupling during translocation
Fluorescence Resonance Energy Transfer (FRET)Labeling SecF and interaction partners with fluorescent probesVisualizes protein-protein interactions in real-time
Surface Plasmon ResonanceImmobilization of SecF on sensor chipsMeasures binding kinetics with other Sec components or substrate proteins
Cross-linking StudiesChemical cross-linking followed by mass spectrometryIdentifies interaction sites between SecF and other proteins

For functional validation in a more physiological context, complementation studies can be performed using E. coli strains with temperature-sensitive mutations in secF. Expression of functional R. akari SecF should restore protein secretion at non-permissive temperatures. Additionally, in vitro translocation assays using purified components of the Sec system can directly assess the contribution of SecF to protein translocation efficiency .

How does the structure-function relationship of SecF contribute to protein translocation in Rickettsia species?

The structure-function relationship of SecF in Rickettsia involves several key domains that work coordinately during protein translocation:

  • Transmembrane domains: Multiple transmembrane helices anchor SecF within the bacterial membrane and form part of the translocation channel. These domains contain conserved residues that interact with the translocating polypeptide chain.

  • Periplasmic loops: Large periplasmic domains of SecF interact with substrate proteins as they emerge from the SecYEG channel. These domains undergo conformational changes that help "pull" the translocating protein through the membrane.

  • Cytoplasmic domains: These regions interact with other components of the translocation machinery, including SecD and YajC, which together form a complex that enhances the efficiency of protein translocation.

The coordinated action of these domains creates a dynamic system that can adapt to various substrate proteins. The SecDF complex is thought to use the proton motive force to drive protein translocation, functioning as a molecular motor that works in concert with the SecYEG translocon to move proteins across the membrane. Mutations in any of these functional domains could potentially disrupt protein translocation, affecting bacterial viability and virulence .

What are common pitfalls in working with recombinant membrane proteins like SecF, and how can they be addressed?

Researchers frequently encounter several challenges when working with recombinant membrane proteins like SecF:

ChallengeCauseSolution Strategy
Poor expression yieldsToxicity to host cells; protein misfoldingUse tightly regulated expression systems; lower induction temperature (16-20°C); co-express chaperones
Protein aggregationHydrophobic transmembrane domains; improper foldingAdd detergents during purification; use solubilization agents; optimize buffer conditions
Loss of native conformationDenaturation during purificationUse milder detergents (DDM, LMNG); include lipids during purification; maintain cold temperature throughout
Instability after purificationProtein degradation; aggregationAdd protease inhibitors; prepare fresh before use; maintain appropriate pH and ionic strength
Difficult reconstitutionIncomplete incorporation into liposomesOptimize lipid composition; use gradual detergent removal methods; verify incorporation by density gradient centrifugation

When troubleshooting recombinant SecF protein work, systematic optimization of expression conditions is essential. For instance, screening multiple E. coli strains (BL21(DE3), C41(DE3), C43(DE3)) that are specialized for membrane protein expression can significantly improve yields. Additionally, fusion partners such as MBP (Maltose Binding Protein) or SUMO can enhance solubility and stability .

How can researchers validate the structural integrity of purified recombinant R. akari SecF protein?

Validating the structural integrity of purified recombinant R. akari SecF protein requires multiple complementary approaches:

  • Circular Dichroism (CD) Spectroscopy: Provides information about secondary structure content (α-helices, β-sheets) and can be used to confirm proper folding. For membrane proteins like SecF, which contain significant α-helical content, CD spectra should show characteristic minima at 208 and 222 nm.

  • Thermal Shift Assays: Measures protein stability by monitoring unfolding as temperature increases. Well-folded proteins typically show cooperative unfolding transitions.

  • Limited Proteolysis: Properly folded proteins show resistance to digestion at specific sites. The digestion pattern can be analyzed by SDS-PAGE and compared to predicted patterns.

  • Size Exclusion Chromatography with Multi-Angle Light Scattering (SEC-MALS): Determines the oligomeric state and homogeneity of the purified protein.

  • Tryptophan Fluorescence Spectroscopy: Monitors the local environment of tryptophan residues, which can indicate proper tertiary structure formation.

For membrane proteins like SecF, additional validation can include reconstitution into nanodiscs or liposomes followed by negative-stain electron microscopy to visualize the protein in a membrane-like environment. This approach can confirm both proper folding and membrane integration .

How is research on rickettsial SecF contributing to our understanding of bacterial protein secretion mechanisms?

Current research on rickettsial SecF is expanding our understanding of bacterial protein secretion in several key areas:

  • Adaptation of secretion systems in obligate intracellular pathogens: Studies on R. akari SecF provide insights into how the Sec translocon has evolved in organisms that are completely dependent on host cells. This research reveals adaptations that optimize protein secretion within the unique intracellular environment .

  • Minimal secretion machinery: Rickettsia species have undergone genome reduction during their evolution as obligate intracellular parasites. Analysis of their Sec systems helps define the minimal essential components required for functional protein secretion, which has implications for synthetic biology applications .

  • Host-pathogen interface dynamics: Research on SecF-dependent extracytoplasmic proteins in Rickettsia is uncovering how these bacteria interact with host cells through secreted effectors. This work is revealing new mechanisms of bacterial manipulation of host cellular processes .

  • Comparative studies across rickettsial species: Examination of SecF across different Rickettsia species (e.g., R. akari, R. rickettsii) is highlighting how variations in protein secretion systems may contribute to differences in tissue tropism, pathogenicity, and host range .

Future research directions will likely focus on in situ structural studies of the entire Sec translocon complex in rickettsial species, potentially using cryo-electron microscopy to visualize the translocation process in native-like environments .

What potential applications exist for targeting SecF in antimicrobial development against rickettsial diseases?

The essential nature of SecF in rickettsial biology makes it an attractive target for antimicrobial development:

Therapeutic ApproachMechanismAdvantage
Small molecule inhibitorsDirect binding to SecF to disrupt functionHigh specificity; potential for broad-spectrum activity against multiple rickettsial species
Peptide-based inhibitorsCompetitive inhibition of substrate bindingMay offer higher selectivity for bacterial vs. host proteins
Combination therapiesTargeting SecF along with other essential systemsReduced resistance development; synergistic effects
Attenuated vaccine developmentStrains with modified SecF functionControlled attenuation while maintaining immunogenicity

Research with R. rickettsii has demonstrated that strains with compromised protein processing show attenuated virulence, suggesting that SecF inhibition could effectively reduce pathogenicity. For example, the highly passaged Iowa strain of R. rickettsii, which fails to properly process certain autotransporters, shows significantly reduced virulence compared to wild-type strains .

Challenges in this approach include ensuring specificity for bacterial SecF while avoiding cross-reactivity with human protein translocation systems. Additionally, the intracellular lifestyle of rickettsiae presents delivery challenges for potential inhibitors. Future therapeutic strategies may involve nanoparticle-based delivery systems designed to target infected cells and release SecF inhibitors intracellularly .

How might advanced techniques like cryo-EM and AlphaFold contribute to understanding SecF structure and function in rickettsial species?

Advanced structural biology techniques are poised to revolutionize our understanding of rickettsial SecF:

  • Cryo-electron microscopy (cryo-EM): This technique can now achieve near-atomic resolution of membrane protein complexes in their native-like environments. For rickettsial SecF, cryo-EM could reveal:

    • The complete architecture of the SecDFYajC-SecYEG supercomplex

    • Conformational changes during different stages of protein translocation

    • Interaction interfaces between SecF and substrate proteins

    • Structural adaptations unique to rickettsial species

  • AlphaFold and other AI-based structure prediction tools: These computational approaches can predict protein structures with unprecedented accuracy, offering advantages such as:

    • Generation of structural models for rickettsial SecF variants that are difficult to express and purify

    • Prediction of protein-protein interaction interfaces between SecF and other translocon components

    • Identification of potential small molecule binding sites for drug development

    • Comparison of SecF structures across different rickettsial species to identify conserved functional domains

  • Integrative structural biology approaches: Combining multiple techniques like hydrogen-deuterium exchange mass spectrometry (HDX-MS), cross-linking mass spectrometry (XL-MS), and single-particle cryo-EM can provide comprehensive insights into both structure and dynamics of the SecF protein and its interactions.

These advanced approaches will likely uncover the molecular mechanisms by which rickettsial SecF has adapted to the unique challenges of protein secretion in an obligate intracellular pathogen, potentially revealing novel targets for therapeutic intervention .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.