Recombinant Rickettsia bellii DNA translocase FtsK (ftsK)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your requests if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All protein shipments are standardly equipped with blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
ftsK; RBE_0154; DNA translocase FtsK
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-749
Protein Length
full length protein
Species
Rickettsia bellii (strain RML369-C)
Target Names
ftsK
Target Protein Sequence
MLYYVNKFLSNSKVQAVILGIIGLATISMLVSYKLDDPSFNSATTGYTNNLLGIFGSYLS DFLYQFFGVAAFIIPLSCFIWGKNCWQQKYRKSFIRISVMLLALFSTAALLSNFDLEFVP SNGGGAAGIIIFHFLKQFTNQLHLLLVFFTFIIFVVLFEIKFTSLSSFIIKLGKFLAYKI QTFFYNLFSQLTLPKLFSGKANNKIKITPSYTKPVNEKIRFTEEPKPIMAKPAPVNPIKF FNKPTVPKISQNDATALPPISLLRNPENHHIKGASSSELKQKAEELLTVLNDFGVKGQII NIGQGPVVTLYEFEPAAGTKTSRVVGLSDDIARSLSALSTRIAVVPGKNVLGIELPNKQR EFFCLKELIETPEYQDTSTLLPLVLGKDLAGKPLIADLAKMPHLLVAGTTGSGKSVGINA MIVSLLYRYTPEECRFIMIDPKMLELSAYDGIPHLLTPVVTEPAKAVVALKWAVKEMENR YRMMSNIGVKNIAGYNTKIQEAVKEGRIIEKSIQTGFDPETGRPIYETVAMNMEKLPFIA VIVDEMADLMLVAGKDIEMLIQRLAQMARAAGIHIIMATQRPSVDVITGVIKANFPSRIS FKVTSKIDSRTILGEQGSEQLLGMGDMLFMGNTSKITRVHGPFVNESEIEQITEYLKETG TPEYISAVTEQSDEDDSSIDIGDGTSDEVLYKKAVQIVRDERKSSISYIQRSLRIGYNKA ANLVEKMEKEGIVSPPNHTGKREILLPER
Uniprot No.

Target Background

Function
Essential cell division protein that coordinates cell division and chromosome segregation. The N-terminus is involved in the assembly of the cell-division machinery. The C-terminus functions as a DNA motor that moves dsDNA in an ATP-dependent manner towards the dif recombination site, located within the replication terminus region. Translocation stops specifically at Xer-dif sites, where FtsK interacts with the Xer recombinase, enabling activation of chromosome unlinking by recombination. FtsK orienting polar sequences (KOPS) guide the direction of DNA translocation. FtsK can remove proteins from DNA during translocation, but translocation stops specifically at XerCD-dif site, preventing the removal of XerC and XerD from dif.
Database Links

KEGG: rbe:RBE_0154

Protein Families
FtsK/SpoIIIE/SftA family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rickettsia bellii and why is it significant for FtsK studies?

Rickettsia bellii is a rickettsial species that infects both argasid and ixodid ticks throughout the Americas. Unlike many other rickettsiae, R. bellii has uncertain pathogenicity in humans while still possessing the ability to infect mammalian hosts in laboratory settings. Studies have demonstrated that when guinea pigs are inoculated with R. bellii, they may develop mild clinical signs and internal pathological changes, suggesting potential mammalian host infectivity . R. bellii is significant for FtsK studies because it represents an opportunity to understand chromosome dynamics in intracellular bacteria with unique genomic characteristics. The successful transformation of R. bellii with shuttle vectors has opened new avenues for genetic manipulation and functional studies of proteins like FtsK .

What is DNA translocase FtsK and what is its primary function?

DNA translocase FtsK is a multifunctional protein essential for bacterial chromosome segregation and cell division. Based on studies in model organisms like Escherichia coli, FtsK pumps double-stranded DNA (dsDNA) directionally at approximately 5 kb/s . Its primary functions include:

  • Directing chromosome translocation during the final stages of cell division

  • Activating site-specific recombination systems to resolve chromosome dimers

  • Facilitating chromosome unlinking by activating XerCD-mediated recombination at specific dif sites

The translocase activity ensures that duplicated chromosomes properly segregate into daughter cells, a process critical for bacterial survival and replication.

How is the structure of FtsK organized and what domains are functionally important?

FtsK typically contains three main structural domains:

  • N-terminal domain: Anchors the protein to the cell membrane and interacts with other cell division proteins

  • Linker region: Connects the N-terminal and C-terminal domains, allowing flexibility

  • C-terminal domain: Contains the motor that drives DNA translocation and includes:

    • α and β subdomains that form the ATPase motor

    • γ regulatory subdomain that recognizes specific DNA sequences and activates recombination

Research has demonstrated that the γ regulatory subdomain of FtsK specifically activates XerD catalytic activity to generate Holliday junction intermediates that are subsequently resolved by XerC . This targeted activation is crucial for ensuring proper chromosome unlinking.

What expression systems are most effective for producing recombinant R. bellii FtsK?

Based on successful transformation experiments with R. bellii, several expression systems have proven effective:

  • Shuttle vector systems: Vectors based on R. amblyommii plasmids (pRAM18 and pRAM32) have been successfully used to transform R. bellii . These systems maintain high copy numbers in R. bellii (13.3-28.1 copies for pRAM18dRGA) , making them potential platforms for FtsK expression.

  • Selection markers: Incorporating rifampin resistance and fluorescent markers (like GFPuv) provides effective selection tools for identifying successfully transformed R. bellii .

  • Electroporation protocols: Direct electroporation of R. bellii with recombinant constructs has yielded GFPuv-expressing rickettsiae within two weeks of transformation .

When designing expression systems, researchers should consider the native regulatory elements of R. bellii to ensure proper protein folding and localization of the recombinant FtsK.

What are the established methods for assessing FtsK translocase activity in vitro?

Several methodological approaches can be employed to assess FtsK translocase activity:

  • DNA pumping assays: Measure the rate of DNA translocation (approximately 5 kb/s in model systems) using:

    • Tethered DNA molecules with force measurement

    • Fluorescence-based tracking of DNA movement

    • Magnetic bead displacement assays

  • XerCD-dif recombination activation assays: Monitor the ability of FtsK to activate site-specific recombination through:

    • Detection of Holliday junction intermediates

    • Quantification of recombination products

    • Analysis of topological status of recombination products

  • ATPase activity measurements: Determine the correlation between ATP hydrolysis and DNA translocation rates.

When conducting these assays with R. bellii FtsK, it's essential to control for potential differences in optimal reaction conditions compared to model organisms.

How can researchers verify successful expression of recombinant R. bellii FtsK?

Verification of recombinant R. bellii FtsK expression can be accomplished through multiple complementary approaches:

  • Western blot analysis: Using antibodies against:

    • Epitope tags incorporated into the recombinant protein

    • Conserved FtsK domains

    • R. bellii-specific FtsK sequences

  • Functional complementation: Testing the ability of recombinant FtsK to restore function in:

    • FtsK-deficient bacterial strains

    • Conditional FtsK mutants

  • Fluorescence microscopy: Visualizing:

    • Fusion proteins with fluorescent tags

    • Localization patterns during cell division

    • Co-localization with DNA or other division proteins

  • Real-time PCR quantification: Similar to the methods used to determine plasmid copy numbers in transformed Rickettsia , qPCR can be used to quantify expression levels of recombinant ftsK genes.

How does the γ subdomain of R. bellii FtsK specifically activate XerCD-dif recombination?

The activation mechanism likely parallels that observed in model organisms, where:

  • The γ subdomain of FtsK directly interacts with XerD, activating its catalytic activity to generate Holliday junction intermediates .

  • This activation is essential for the proper initiation of the recombination process, which is subsequently completed by XerC resolving the Holliday junctions .

  • In the absence of proper FtsK translocation activity, the activation of recombination can still occur, but the recombination products become topologically complex and would impair chromosome unlinking rather than facilitating it .

Research into R. bellii-specific mechanisms should focus on:

  • Identifying the specific protein-protein interaction domains between R. bellii FtsK and XerD

  • Determining whether the KOPS (FtsK-Orienting Polar Sequences) recognition patterns differ in R. bellii

  • Assessing how the intracellular lifestyle of R. bellii might influence this activation process

What are the implications of R. bellii's plasmid maintenance systems for recombinant FtsK studies?

R. bellii's ability to maintain multiple plasmids presents both opportunities and challenges for FtsK studies:

  • Stable transformation platform: R. bellii has demonstrated the capacity to maintain high copy numbers of shuttle vectors (13.3-28.1 copies of pRAM18dRGA per cell) , providing a robust platform for recombinant protein expression.

  • Potential regulatory interactions: Native plasmid maintenance systems might interact with chromosome segregation machinery, including FtsK, potentially affecting:

    • Expression levels of recombinant proteins

    • Localization patterns

    • Functional activities

  • Evolutionary insights: Studying how FtsK functions in a bacterium that naturally maintains multiple plasmids could provide insights into the co-evolution of chromosome and plasmid segregation systems.

Researchers should consider designing experiments that account for these plasmid-chromosome dynamics when studying recombinant FtsK in R. bellii.

How might FtsK function relate to the pathogenicity or host adaptation of Rickettsia species?

The potential relationship between FtsK function and Rickettsia pathogenicity presents an intriguing research direction:

  • Cell division in host environments: Proper chromosome segregation mediated by FtsK is essential for bacterial replication within host cells. Research indicates that R. bellii can cause pathological changes in guinea pig models, suggesting successful replication in mammalian hosts .

  • Stress response during host infection: FtsK's role in resolving chromosome dimers may be particularly important during stress conditions encountered during host infection.

  • Comparative analysis opportunities: Studies have established methods for detecting and differentiating R. bellii from other rickettsial species, including PCR assays targeting the citrate synthase (gltA) gene . Similar approaches could be used to study ftsK gene expression during different infection stages.

Research focusing on how FtsK activity varies across different Rickettsia species with varying pathogenicity (such as R. bellii, R. amblyommatis, and R. montanensis) could provide valuable insights into the role of chromosome dynamics in rickettsial virulence .

What are the major challenges in purifying functional recombinant R. bellii FtsK?

Purification of functional R. bellii FtsK presents several technical challenges:

  • Membrane association: The N-terminal domain of FtsK typically anchors the protein in the membrane, making it difficult to purify in its full-length, native conformation.

  • Large protein size: Complete FtsK proteins are typically large (>800 amino acids), presenting challenges for complete expression and proper folding.

  • Obligate intracellular nature of Rickettsia: The requirement for host cells complicates large-scale protein production.

Recommended approaches include:

  • Expression of functional domains (particularly the C-terminal motor domain) rather than the full-length protein

  • Use of specialized detergents for membrane protein extraction

  • Implementation of fusion tags that enhance solubility while maintaining function

  • Employment of shuttle vector systems already demonstrated effective in R. bellii

How can researchers distinguish between direct and indirect effects when studying recombinant FtsK in Rickettsia?

Distinguishing direct from indirect effects requires rigorous experimental design:

  • Domain-specific mutants: Generate variants with mutations in specific functional domains:

    • ATP-binding motifs to disrupt motor function

    • DNA-binding regions to alter KOPS recognition

    • XerD interaction sites to prevent recombination activation

  • Complementation studies: Test whether wild-type FtsK can rescue phenotypes of mutant variants.

  • In vitro reconstitution: Isolate the biochemical activities by reconstituting:

    • DNA translocation with purified components

    • XerCD-dif recombination systems

    • Protein-protein interaction networks

  • Time-resolved studies: Monitor the sequence of events following FtsK activation to establish causality between FtsK activity and downstream effects.

When interpreting results, researchers should consider that in some experimental systems, the γ subdomain of FtsK can activate XerCD-dif recombination in the absence of the translocase domain , highlighting the importance of analyzing domain-specific functions.

What methodological approaches can resolve contradictory data regarding FtsK function in Rickettsia?

When faced with contradictory results, several methodological approaches can help resolve discrepancies:

  • Standardization of experimental conditions: Control for variations in:

    • Growth conditions of Rickettsia

    • Transformation protocols

    • Expression levels of recombinant proteins

    • Assay conditions for functional tests

  • Multi-technique validation: Employ complementary methods to verify findings:

    • Combine genetic, biochemical, and microscopy approaches

    • Validate in vitro findings with in vivo experiments

    • Use both gain-of-function and loss-of-function approaches

  • Evolutionary context analysis: Compare FtsK function across:

    • Different Rickettsia species (pathogenic vs. non-pathogenic)

    • Related intracellular bacteria

    • Model organisms with well-characterized FtsK systems

  • Quantitative approaches: Move beyond qualitative assessments to:

    • Measure translocation rates under different conditions

    • Quantify recombination efficiency

    • Determine binding affinities for interaction partners

By implementing these methodological approaches, researchers can develop a more coherent understanding of FtsK function in R. bellii and resolve apparent contradictions in experimental data.

How might CRISPR-Cas systems be adapted for studying FtsK function in R. bellii?

CRISPR-Cas-based approaches offer promising strategies for R. bellii FtsK studies:

  • Gene editing: Use CRISPR-Cas9 or Cas12 systems delivered via established transformation methods to:

    • Generate domain-specific mutations in native ftsK

    • Create conditional expression systems

    • Introduce reporter tags at the endogenous locus

  • CRISPRi systems: Deploy catalytically inactive Cas proteins fused to repressors to:

    • Achieve temporal control of ftsK expression

    • Study the effects of FtsK depletion on cell division

    • Identify genetic interactions by combinatorial targeting

  • CRISPR-based imaging: Employ fluorescently tagged dCas proteins to:

    • Visualize the localization of FtsK in living Rickettsia

    • Track chromosome dynamics during division

    • Monitor interactions with other division proteins

Implementation would require optimization of the shuttle vector systems already demonstrated to function in R. bellii , with careful attention to the selection markers and expression control elements.

What insights might comparative genomics provide about FtsK evolution in Rickettsia species?

Comparative genomics approaches can reveal evolutionary patterns in FtsK function:

  • Domain conservation analysis: Compare sequence conservation across:

    • Different Rickettsia species with varying pathogenicity

    • Related intracellular bacteria

    • Free-living relatives

  • KOPS distribution mapping: Analyze the distribution of FtsK-orienting polar sequences to:

    • Identify Rickettsia-specific recognition patterns

    • Correlate KOPS distribution with genome architecture

    • Detect potential adaptations related to the intracellular lifestyle

  • Co-evolution studies: Investigate co-evolutionary patterns between:

    • FtsK and its interaction partners (XerC/D)

    • FtsK and other cell division proteins

    • FtsK and host interaction factors

Such analyses could provide insights into how FtsK function has adapted during the evolution of Rickettsia species with different host ranges and pathogenicity profiles.

How might understanding R. bellii FtsK contribute to development of new anti-rickettsial strategies?

Understanding R. bellii FtsK function could inform novel anti-rickettsial approaches:

  • Target identification: FtsK's essential role in chromosome segregation makes it a potential target for:

    • Small molecule inhibitors that block translocation

    • Peptides that disrupt protein-protein interactions

    • Compounds that interfere with ATP binding or hydrolysis

  • Rational drug design: Structural and functional studies of R. bellii FtsK could enable:

    • Structure-based virtual screening for inhibitors

    • Fragment-based drug discovery approaches

    • Design of allosteric modulators

  • Broad-spectrum potential: Targeting conserved aspects of FtsK function might provide activity against multiple rickettsial species, including those with known pathogenicity in humans.

  • Host-pathogen interface considerations: Studies in guinea pig models have demonstrated that R. bellii can cause pathological changes , suggesting that targeting FtsK could interfere with Rickettsia replication in mammalian hosts.

Research in this direction would benefit from the growing toolkit for rickettsial transformation and the development of animal models for studying rickettsial infection .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.