Recombinant Rickettsia bellii Probable ABC transporter permease protein RBE_1340 (RBE_1340)

Shipped with Ice Packs
In Stock

Description

Genomic Context and Phylogenetic Significance

  • Genomic Location: RBE_1340 is positioned between RBE_1339 (alanine racemase) and RBE_1341 (ABC transporter ATP-binding protein) in the R. bellii genome .

  • Conservation: RBE_1340 is absent in pathogenic spotted fever and typhus group Rickettsia, highlighting its uniqueness to basal rickettsiae .

  • Phylogenetic Analysis: R. bellii diverged early in rickettsial evolution, and its ABC transporters may reflect ancestral metabolic adaptations .

Functional Role in ABC Transporters

ABC transporters typically consist of:

  1. Permease component (RBE_1340): Mediates transmembrane substrate translocation.

  2. ATP-binding component (e.g., RBE_1341): Hydrolyzes ATP to energize transport .

Proposed Substrates:

  • Given its genomic neighbors (e.g., ribose-phosphate pyrophosphokinase prs), RBE_1340 may transport nucleotides or metabolic intermediates .

  • Homologs in other bacteria are implicated in drug resistance, but experimental validation is pending for RBE_1340 .

Research Significance and Gaps

  • Evolutionary Insight: RBE_1340’s absence in pathogenic Rickettsia suggests divergent survival strategies between basal and pathogenic groups .

  • Unanswered Questions:

    • Substrate specificity and physiological role in R. bellii.

    • Structural dynamics (e.g., transmembrane topology) remain uncharacterized .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
RBE_1340; Probable ABC transporter permease protein RBE_1340
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-259
Protein Length
full length protein
Species
Rickettsia bellii (strain RML369-C)
Target Names
RBE_1340
Target Protein Sequence
MLLNIANSIGKRTIRLAQSIGKFSIFSLAAITSIIRPPLYFSLIIKQLLFIGFYSLPVVA MTTFFSGAVLALQSYTGFSRFSAESSIATVVVLSLTRELGPVLAGLMVAGRVGASIAAEI GTMRVTEQVDALYTLSTDSIKYLVFPKVIAAIITMPCLVLIGDVIGVMGGYLVGVYKLDF NSSTYLTSTFQYLEPIDVISGLVKAGVFGFIISIISCYSGYYSGKGAKGVGRATTSAVVN SSILILISNYLITELFFKV
Uniprot No.

Target Background

Function
May be a component of an ABC transporter complex.
Database Links

KEGG: rbe:RBE_1340

Protein Families
MlaE permease family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How is RBE_1340 typically expressed and purified for research applications?

The expression and purification of RBE_1340 involve several methodological considerations due to its nature as a membrane protein. The standard protocol utilizes E. coli as an expression host with the protein fused to an N-terminal His tag . This approach enables affinity purification using metal chelate chromatography.

The expression process typically follows these steps:

  • Clone the RBE_1340 gene into an expression vector with an N-terminal His tag

  • Transform into an appropriate E. coli strain (often BL21(DE3) or derivatives)

  • Induce protein expression (commonly with IPTG for T7-based systems)

  • Harvest cells and disrupt membranes using detergents appropriate for membrane proteins

  • Purify using Ni-NTA or similar affinity chromatography

  • Perform quality control analyses including SDS-PAGE to confirm purity (typically >90%)

After purification, the protein is often lyophilized for long-term storage. For experimental use, reconstitution in an appropriate buffer system with 5-50% glycerol is recommended, followed by aliquoting to avoid repeated freeze-thaw cycles that may compromise protein stability .

What are the typical storage and handling requirements for working with recombinant RBE_1340?

Proper storage and handling of recombinant RBE_1340 are critical for maintaining protein integrity and experimental reproducibility. The protein is typically supplied as a lyophilized powder and should be stored at -20°C to -80°C upon receipt . The reconstitution process significantly impacts protein stability and functionality. Researchers should:

  • Briefly centrifuge the vial prior to opening to ensure the lyophilized protein collects at the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (with 50% being standard practice) to prevent damage during freeze-thaw cycles

  • Prepare smaller working aliquots to avoid repeated freezing and thawing of the entire stock

  • Store working aliquots at 4°C for short-term use (up to one week)

  • For long-term storage, keep aliquots at -20°C or preferably -80°C

The storage buffer typically consists of a Tris/PBS-based system with 6% trehalose at pH 8.0, which helps maintain protein stability during freeze-thaw cycles . When designing experiments, researchers should consider that repeated freeze-thaw cycles can lead to protein denaturation and loss of functional activity.

What is the general function of ABC transporter permease proteins like RBE_1340?

ABC transporter permease proteins like RBE_1340 serve as integral membrane components that form the substrate translocation pathway in ABC (ATP-Binding Cassette) transport systems. These systems are involved in the energy-dependent transport of a wide variety of substrates across cellular membranes. The general structure of ABC transporters includes:

  • Transmembrane domains (TMDs) - typically permease proteins like RBE_1340

  • Nucleotide-binding domains (NBDs) - bind and hydrolyze ATP to power transport

  • Optional substrate-binding proteins (for import systems)

The permease component forms a channel or pore through which specific substrates are moved across the membrane. This transport is coupled to ATP hydrolysis by the associated nucleotide-binding domains. ABC transporters can function as importers (bringing substances into the cell) or exporters (removing substances from the cell) .

While the specific substrate for RBE_1340 hasn't been definitively characterized in the available search results, research on other ABC transporters provides insights into possible functions. For example, plant ABCB14 mediates malate uptake when expressed in E. coli and HeLa cells, and plant ABCD proteins are involved in peroxisomal fatty acyl-CoA import through a mechanism involving substrate cleavage followed by re-esterification .

What biological role does Rickettsia bellii play, and why study its proteins?

Rickettsia bellii is a gram-negative, obligate intracellular α-proteobacterium belonging to the genus Rickettsia. This genus is divided into four clades or groups based on phylogenetic analysis, with R. bellii being a species of particular interest due to its geographic distribution and host range .

Traditionally, Rickettsia species were primarily associated with arthropod vectors like ticks, but recent research has identified R. bellii in mosquitoes in China, specifically in Culex pipiens pallens (4.3%) and Anopheles sinensis (0.6%) . This finding is significant as it demonstrates that R. bellii can occur outside of the Americas and in hosts other than its usual tick vectors.

Studying R. bellii proteins, particularly membrane proteins like RBE_1340, is valuable for several reasons:

  • Understanding bacterial adaptation mechanisms to diverse host environments

  • Investigating potential roles in pathogenicity and host-pathogen interactions

  • Exploring evolutionary relationships within the Rickettsia genus

  • Identifying potential targets for antimicrobial development

  • Gaining insights into essential cellular processes through the study of conserved ABC transport systems

Research on R. bellii proteins contributes to the broader understanding of bacterial physiology and potential mechanisms of bacterial survival in different host organisms .

What experimental approaches can be used to determine the substrate specificity of RBE_1340?

Determining the substrate specificity of an ABC transporter permease like RBE_1340 requires a multi-faceted approach that combines structural analysis, functional assays, and comparative genomics. Several methodological strategies can be employed:

Reconstitution in Liposomes and Transport Assays:

  • Purify RBE_1340 and its associated NBD partner (if known)

  • Reconstitute the proteins into liposomes with controlled internal composition

  • Perform transport assays using radiolabeled or fluorescently tagged potential substrates

  • Monitor substrate accumulation or efflux using appropriate detection methods

Heterologous Expression Systems:

  • Express RBE_1340 and its complete transport system in heterologous hosts like E. coli or yeast

  • Assess changes in substrate sensitivity, resistance, or accumulation

  • Use complementation studies in strains with deleted transporters of known function

This approach has been successfully used with other ABC transporters, such as Arabidopsis ABCB14, which was shown to mediate malate uptake when expressed in E. coli and HeLa cells .

Binding Studies Using Purified Components:

  • Use isothermal titration calorimetry (ITC) to measure binding affinities for potential substrates

  • Apply surface plasmon resonance (SPR) to study interaction kinetics

  • Employ fluorescence-based binding assays with environmentally sensitive probes

Structural and Computational Approaches:

  • Generate homology models based on crystal structures of related ABC transporters

  • Conduct molecular dynamics (MD) simulations to identify potential substrate binding sites

  • Use site-directed mutagenesis to validate computational predictions

  • Apply molecular docking to screen potential substrates in silico

Researchers studying ABC transporters have successfully combined these approaches, as evidenced by studies on P-gp that used homology modeling with MD and site-directed spin labeling with EPR spectroscopy to investigate drug binding and conformational dynamics .

How can advanced structural biology techniques be applied to study RBE_1340?

Understanding the structure-function relationship of RBE_1340 requires application of multiple complementary structural biology techniques. Several advanced approaches can provide valuable insights:

X-ray Crystallography:

  • Purify RBE_1340 to high homogeneity (>95%)

  • Screen for crystallization conditions, often requiring detergent optimization for membrane proteins

  • Collect diffraction data and solve the structure

  • Analyze substrate binding sites and conformational changes

Cryo-Electron Microscopy (Cryo-EM):

  • Prepare RBE_1340 samples in vitreous ice

  • Collect high-resolution image data

  • Process and reconstruct 3D structure

  • Particularly valuable for capturing different conformational states of the transport cycle

EPR Spectroscopy with Site-Directed Spin Labeling:

  • Introduce cysteine residues at strategic positions in RBE_1340

  • Label with spin probes

  • Measure distances between labeled residues

  • Monitor conformational changes during the transport cycle

This approach has been successfully applied to other ABC transporters like MsbA and P-gp to investigate conformational flexibility and compare dynamic data with mechanistic predictions from crystal structures .

Molecular Dynamics Simulations:

  • Create atomic models based on experimental structures or homology models

  • Simulate protein dynamics in a lipid bilayer environment

  • Investigate conformational changes and substrate interactions

  • Identify water molecules critical for transport mechanism

X-ray Radiolytic Footprinting Combined with Mass Spectrometry (XF-MS):

  • Expose protein samples to X-ray radiolysis

  • Analyze resulting modifications by mass spectrometry

  • Identify structural waters and conformational changes

  • Particularly useful for protein complexes

This emerging technique, while not yet widely applied to ABC transporters, offers valuable insights into protein dynamics and is applicable to protein complexes, making it potentially valuable for studying complete ABC transporter assemblies .

What are the challenges in expressing full-length membrane proteins like RBE_1340, and how can they be addressed?

Expressing full-length membrane proteins like RBE_1340 presents several significant challenges that researchers must overcome to obtain functional protein for study. These challenges and their potential solutions include:

ChallengeDescriptionSolution Strategies
HydrophobicityMembrane proteins contain hydrophobic transmembrane domains that can cause aggregation and misfolding1. Use specialized E. coli strains (C41, C43) designed for membrane protein expression
2. Lower induction temperature (16-20°C)
3. Add solubilizing agents or mild detergents to expression media
Codon OptimizationRare codons in the target gene can slow translation and reduce yield1. Perform codon optimization for the expression host
2. Use strains with extra copies of rare tRNAs (Rosetta, CodonPlus)
Protein ToxicityOverexpression of membrane proteins can disrupt host cell membranes1. Use tightly controlled inducible promoters
2. Reduce expression levels with lower inducer concentrations
3. Use bacterial strains with increased membrane surface area
Translation Initiation ProblemsImproper initiation can lead to truncated products1. Use expression vectors with fusion tags on both N and C termini
2. Optimize Shine-Dalgarno sequence
3. Increase imidazole concentration during elution to separate full-length from truncated products
ProteolysisDegradation of expressed protein1. Add protease inhibitors during extraction and purification
2. Use protease-deficient host strains
3. Optimize extraction conditions to minimize exposure time
Proper FoldingEnsuring native conformation in heterologous systems1. Express in eukaryotic systems for complex proteins
2. Co-express with chaperones
3. Use fusion partners that enhance solubility (MBP, SUMO, Trx)

For transmembrane proteins like RBE_1340, maintaining the native conformation is critical for functional studies. The nanoscale cell membrane particles (MNP) platform can be particularly useful as it extracts high-purity membrane fragments while preserving the conformation and activity of embedded membrane proteins .

When specifically expressing RBE_1340, researchers should analyze the protein's hydrophobicity profile and secondary structure predictions to optimize expression conditions. The protein sequence (259 amino acids) contains multiple hydrophobic regions consistent with its role as a transmembrane permease, requiring careful consideration of solubilization and purification strategies .

How does the function of Rickettsia bellii ABC transporters compare to those in other bacterial species?

ABC transporters represent one of the largest protein families and perform diverse functions across bacterial species. Comparing Rickettsia bellii ABC transporters, including RBE_1340, to those in other bacteria reveals important evolutionary and functional insights:

Evolutionary Context:
Rickettsia bellii belongs to the alpha-proteobacteria and is an obligate intracellular bacterium. This lifestyle has led to genome reduction and specialization compared to free-living bacteria. ABC transporters in obligate intracellular bacteria often show evidence of:

  • Reduced diversity of substrate specificity

  • Retention of transporters essential for survival in the intracellular niche

  • Potential loss of importers for nutrients available from the host

  • Conservation of exporters that may be involved in virulence or host interaction

Functional Comparisons:
While the specific function of RBE_1340 is not definitively characterized in the search results, comparative analysis with other bacterial ABC transporters suggests potential roles:

  • Nutrient Acquisition: In free-living bacteria like E. coli, ABC importers facilitate uptake of diverse nutrients. In Rickettsia, which obtains many nutrients from its host, ABC importers may be specialized for essential compounds not available from the host.

  • Drug Resistance: Many bacterial ABC exporters, such as MacAB in E. coli, function in antimicrobial resistance. Similar systems in Rickettsia may contribute to resistance against host defense molecules.

  • Maintenance of Membrane Integrity: ABC transporters involved in lipid trafficking and membrane maintenance are often conserved across bacterial species, suggesting RBE_1340 might function in similar processes.

  • Host-Pathogen Interactions: Some bacterial ABC transporters export virulence factors or modulate host immune responses. Given Rickettsia's intracellular lifestyle, RBE_1340 could potentially function in these interactions.

Methodological Approaches for Comparative Studies:

  • Comparative genomics to identify orthologous ABC transporters across species

  • Heterologous expression of RBE_1340 in model bacteria to assess functional complementation

  • Structural comparisons with well-characterized bacterial ABC transporters

  • Transcriptomic analysis to determine expression patterns under different conditions

The study of R. bellii in diverse hosts, including mosquitoes outside its traditional geographic range , provides an opportunity to investigate how ABC transporters may contribute to adaptation to different host environments.

What techniques can be used to study the conformational dynamics of RBE_1340 during the transport cycle?

Understanding the conformational changes that ABC transporters undergo during substrate transport is crucial for elucidating their mechanism. Several advanced techniques can be employed to study the conformational dynamics of RBE_1340:

EPR Spectroscopy with Site-Directed Spin Labeling:
This powerful approach involves introducing cysteine residues at specific positions in RBE_1340 and labeling them with spin probes. The technique provides valuable information about:

  • Distances between labeled residues (using double electron-electron resonance, DEER)

  • Local environment of the probe (continuous wave EPR)

  • Conformational changes during the transport cycle

  • Accessibility of different protein regions

This approach has been successfully applied to ABC transporters like MsbA and P-gp to compare dynamic data with mechanistic predictions from crystal structures in different conformations .

Fluorescence-Based Approaches:

  • FRET (Förster Resonance Energy Transfer): By labeling RBE_1340 with donor and acceptor fluorophores, researchers can monitor distance changes between domains during the transport cycle.

  • Cysteine-Reactive Fluorescent Reagents: This approach has been used to investigate the catalytic cycle of MsbA in the framework of crystal structures .

  • Single-Molecule FRET: Provides insights into the heterogeneity of conformational states and transient intermediates.

Hydrogen-Deuterium Exchange Mass Spectrometry (HDX-MS):
This technique monitors the exchange of hydrogen atoms with deuterium in the protein backbone, revealing:

  • Regions of structural flexibility

  • Conformational changes upon substrate binding

  • Allosteric effects throughout the protein

  • Protein-protein interaction interfaces

X-ray Radiolytic Footprinting Combined with Mass Spectrometry (XF-MS):
This emerging technique offers valuable insights into:

  • Protein dynamics

  • Identification of structural waters important for function

  • Conformational changes in proteins

  • Analysis of protein complexes

While not yet widely applied to ABC transporters, XF-MS holds promise for studying complete ABC transporter assemblies .

Molecular Dynamics Simulations:
Computational approaches complement experimental methods by:

  • Simulating protein dynamics in a membrane environment

  • Identifying transient states difficult to capture experimentally

  • Providing atomic-level details of conformational changes

  • Generating hypotheses that can be tested experimentally

Researchers have successfully combined MD simulations with homology modeling to analyze drug binding to P-gp , and similar approaches could be applied to RBE_1340.

Time-Resolved Cryo-EM:
By capturing snapshots of the transport cycle using rapid freezing at different time points after initiation of transport, researchers can visualize the conformational trajectory of the transporter.

The most powerful approach involves combining multiple techniques to build a comprehensive understanding of RBE_1340's conformational dynamics throughout the transport cycle.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.