Recombinant Rickettsia bellii Probable intracellular septation protein A (RBE_0324)

Shipped with Ice Packs
In Stock

Description

Physicochemical Properties

PropertySpecification
Molecular Weight~20 kDa (calculated)
Purity>90% (SDS-PAGE verified)
FormLyophilized powder
Storage BufferTris/PBS-based buffer, 6% Trehalose
Storage Temperature-20°C/-80°C (long-term)

Expression Systems

RBE_0324 is typically expressed in Escherichia coli due to high yield and cost-efficiency . Alternative systems include:

  • Insect cells: For post-translational modifications.

  • Yeast: Balances yield and eukaryotic processing.

  • Mammalian cells: Retains native protein activity but is less common .

Reconstitution Protocol

  1. Centrifuge lyophilized powder briefly.

  2. Reconstitute in sterile water (0.1–1.0 mg/mL).

  3. Add glycerol (5–50% final concentration) for stability .

Immunological Studies

RBE_0324 is used in ELISA kits (e.g., CSB-CF638437RAa1) to study antibody responses in Rickettsia-host interactions .

Functional Insights

  • Septation Role: Homology suggests involvement in bacterial cell division, though direct mechanistic studies are pending .

  • Conjugation Machinery: R. bellii possesses tra genes for conjugation, but RBE_0324’s role in this process remains unexplored .

Pathogenicity

While R. bellii is considered less pathogenic than other Rickettsia species, RBE_0324 may contribute to survival in arthropod or mammalian hosts .

Genetic Diversity

Phylogenetic analyses of R. bellii strains reveal continental divergence (North vs. South America), but RBE_0324’s variability across isolates is unstudied .

Epidemiological Relevance

RBE_0324 has been detected in Ixodes loricatus ticks from Argentina, highlighting its presence in enzootic cycles .

Future Directions

  • Structural Studies: X-ray crystallography or cryo-EM to resolve 3D conformation.

  • Host Interactions: Knockout models to assess septation or virulence roles.

  • Diagnostic Development: Antigenic epitope mapping for serological assays.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format we have in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: Our proteins are typically shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yciB; RBE_0324; Inner membrane-spanning protein YciB
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-180
Protein Length
full length protein
Species
Rickettsia bellii (strain RML369-C)
Target Names
RBE_0324
Target Protein Sequence
MFKLLSEIGPVVAFFAGFFYGGGIQSATLYMLITSVICITLCYIIDKKVSRLSIISTAVL LVSGIITLISGDSMYIKIKPTILYVIFGIIFLTSGIKKNPFIKYALESIIRLKEESWITL SYRTATFFFFMAIVNEIVWRNFPDETWVKFKVFGVVPITFVFILLQLPLLLKNKLPDSKI
Uniprot No.

Target Background

Function
Recombinant Rickettsia bellii Probable intracellular septation protein A (RBE_0324) plays a role in cell envelope biogenesis, maintaining cell envelope integrity and membrane homeostasis.
Database Links

KEGG: rbe:RBE_0324

Protein Families
YciB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is RBE_0324 and what is its significance in Rickettsia bellii?

RBE_0324 is classified as a probable intracellular septation protein A found in Rickettsia bellii, suggesting its potential role in cell division processes within this bacterium. The protein consists of 180 amino acids in its full-length form and is part of the molecular machinery that enables R. bellii to function as an obligate intracellular bacterium . Its significance stems from R. bellii's evolutionary position as part of a basal group of rickettsiae that diverged prior to the pathogenic spotted fever group and typhus group Rickettsia species . Understanding RBE_0324 may provide insights into the basic cellular processes that allowed rickettsiae to adapt to intracellular lifestyles.

How is recombinant RBE_0324 typically produced for research purposes?

Recombinant RBE_0324 is typically produced using E. coli expression systems, with the addition of a histidine tag to facilitate purification. The full-length protein (amino acids 1-180) is expressed from the R. bellii genome sequence . The production typically involves:

  • Cloning the RBE_0324 gene into an appropriate expression vector

  • Transforming the construct into a suitable E. coli strain

  • Inducing protein expression under optimized conditions

  • Lysing the cells and purifying the His-tagged protein using affinity chromatography

  • Quality control testing to verify protein identity, purity, and functionality

This approach yields research-grade protein suitable for various biochemical and structural studies.

What are the typical applications for recombinant RBE_0324 in research settings?

Recombinant RBE_0324 serves multiple research applications, including:

  • Studying protein-protein interactions, particularly given that R. bellii proteins are enriched with ankyrin and tetratricopeptide repeat motifs that mediate such interactions

  • Investigating the role of septation proteins in obligate intracellular bacterial replication

  • Developing antibodies for immunological detection of natural protein in infected tissues

  • Comparative biochemical studies across different Rickettsia species or isolates

  • Structural biology investigations to elucidate function

When designing experiments with this protein, researchers should consider its potential interactions with host cell factors, as these may be critical to understanding its native function.

How does the genetic variation of RBE_0324 correlate with the distinct lineages of R. bellii across North and South America?

The genetic variation in RBE_0324 likely follows the broader phylogeographical patterns observed across R. bellii lineages. Phylogenetic analysis has revealed a clear separation between North American and South American isolates of R. bellii, suggesting they have independently radiated within their respective continents .

To study this variation specifically for RBE_0324:

  • Multiple sequence alignment should be performed using RBE_0324 sequences from diverse geographical isolates

  • Analysis should incorporate both coding sequence and protein structural predictions

  • Selection pressure analysis (dN/dS ratios) can identify functional constraints on the protein

  • Correlation with host tick species may reveal co-evolutionary patterns

This approach would allow researchers to determine whether RBE_0324 is under purifying selection (suggesting conserved function) or diversifying selection (potentially indicating host-specific adaptations). While current data doesn't specifically address RBE_0324 variation, the methods used for broader phylogenetic analysis of R. bellii can be applied to this specific gene.

What experimental approaches are recommended for investigating the protein-protein interactions of RBE_0324?

Given that R. bellii contains numerous proteins with ankyrin repeats and tetratricopeptide repeats associated with protein-protein interactions , investigating RBE_0324's interaction network requires sophisticated approaches:

  • Yeast Two-Hybrid Screening: Using RBE_0324 as bait against either R. bellii genomic libraries or host cell libraries

  • Co-immunoprecipitation with Mass Spectrometry:

    • Express tagged RBE_0324 in appropriate cellular contexts

    • Purify protein complexes using affinity chromatography

    • Identify binding partners via LC-MS/MS analysis

  • Proximity-based Labeling Methods:

    • Generate BioID or APEX2 fusions with RBE_0324

    • Express in relevant cell types

    • Identify proximal proteins through biotinylation and streptavidin pulldown

  • Surface Plasmon Resonance or Biolayer Interferometry:

    • For quantitative measurement of identified interactions

    • Determine binding kinetics and affinity constants

  • Structural Studies:

    • X-ray crystallography or cryo-EM of RBE_0324 with interacting partners

    • Mapping interaction domains through truncation and mutation analysis

These methods should be applied in a complementary manner, as each has distinct strengths and limitations for identifying physiologically relevant interactions.

How should researchers design experiments to investigate the role of RBE_0324 in the stringent response pathway of R. bellii?

The multiple copies of spoT genes in R. bellii suggest the stringent response pathway remains important for this obligate intracellular bacterium . To investigate RBE_0324's potential role in this pathway:

  • Comparative Genomic Analysis:

    • Analyze the genomic context of RBE_0324 for proximity to known stringent response genes

    • Examine conservation patterns across rickettsial species

  • Protein-Protein Interaction Studies:

    • Test for direct interactions between RBE_0324 and SpoT proteins

    • Investigate interactions with other components of the stringent response pathway

  • Functional Complementation Assays:

    • Express RBE_0324 in heterologous bacterial systems with mutations in septation proteins

    • Assess rescue of growth or septation phenotypes

  • Metabolite Analysis:

    • Measure (p)ppGpp levels in systems with modulated RBE_0324 expression

    • Compare metabolite profiles under various stress conditions

  • Structural Biology Approach:

    • Determine if RBE_0324 structure contains domains associated with stringent response signaling

    • Identify potential allosteric sites that might respond to stringent response second messengers

This multifaceted approach can reveal whether and how RBE_0324 integrates bacterial cell division with the stress response pathway in these obligate intracellular bacteria.

What are the appropriate controls and experimental design considerations when studying recombinant RBE_0324 protein function?

When designing experiments to study RBE_0324 function, rigorous experimental design is essential:

Experimental ConsiderationRecommended ApproachCommon Pitfalls to Avoid
Protein Expression ControlsInclude both vector-only and unrelated His-tagged protein controlsUsing only buffer controls without protein
Activity AssaysMatch buffer conditions to physiological environment of R. belliiUsing standard E. coli-based conditions that may not reflect intracellular environment
Stability TestingVerify protein stability throughout experimental timeframe using analytical methodsAssuming protein remains active throughout longer experiments
Host Cell ContextUse relevant tick cell lines when possible for functional studiesRelying solely on mammalian cell lines that may lack relevant interaction partners
Blocking StudiesUse specific antibodies against RBE_0324 to confirm observed effectsUsing commercial antibodies without validation in R. bellii system
Statistical DesignUse appropriate blocking designs when testing across multiple conditions Failing to account for batch effects in protein preparation

Additionally, researchers should consider within-subject designs when measuring effects across multiple conditions to control for variability . This approach increases statistical power and reduces the influence of confounding factors.

How should researchers approach data presentation when reporting findings on RBE_0324?

When presenting research findings on RBE_0324, follow these guidelines for maximum clarity and scientific impact :

  • Text Presentation:

    • Interpret data rather than merely stating values (e.g., "RBE_0324 expression levels decreased significantly after treatment" rather than just listing values)

    • Avoid redundant qualitative words like "remarkably" or "extremely" - let the data demonstrate significance

    • Use past tense when describing results

  • Table Design:

    • Create self-explanatory tables with clear titles that summarize variables

    • Organize similar data in columns for easier comparison

    • List dependent variables in columns and independent variables in rows

    • Use footnotes for statistical significance rather than separate columns for p-values

  • Graphics Approach:

    • Use figures to highlight trends and relationships

    • Select the appropriate visualization for your data type (e.g., bar charts for comparisons, line graphs for time series)

    • Ensure graphics are independently understandable with comprehensive legends

  • Statistical Reporting:

    • Report exact p-values rather than simply stating significance

    • Include relevant effect sizes alongside significance tests

    • Present confidence intervals where appropriate

This structured approach to data presentation enhances the clarity and impact of research findings on RBE_0324.

What approaches can be used to study the evolutionary history of RBE_0324 across Rickettsia species?

To investigate the evolutionary history of RBE_0324 across Rickettsia species, researchers should implement a systematic phylogenetic approach:

  • Sequence Collection and Alignment:

    • Obtain RBE_0324 homologs from diverse Rickettsia species

    • Include outgroup sequences from related bacterial genera

    • Perform multiple sequence alignment using programs like MUSCLE or MAFFT

    • Manually inspect and refine alignments to ensure accuracy

  • Phylogenetic Analysis:

    • Select appropriate evolutionary models using ModelTest or similar tools

    • Construct phylogenetic trees using maximum likelihood, Bayesian methods, and distance-based approaches

    • Compare North and South American R. bellii isolates specifically

    • Assess node support through bootstrap analysis or posterior probabilities

  • Selection Analysis:

    • Calculate dN/dS ratios to identify selection pressures

    • Use sliding window analysis to identify domains under different selection regimes

    • Implement codon-based tests for selection using PAML or HyPhy

  • Ancestral Sequence Reconstruction:

    • Infer ancestral RBE_0324 sequences at key evolutionary nodes

    • Express reconstructed proteins for functional comparison

  • Comparative Genomic Context:

    • Analyze the genomic neighborhood of RBE_0324 across species

    • Identify gene order conservation or rearrangements

This comprehensive approach can reveal both the tempo and mode of RBE_0324 evolution and provide insights into its functional constraints.

How can researchers effectively design experiments to investigate the subcellular localization of RBE_0324?

Determining the subcellular localization of RBE_0324 requires specialized approaches for intracellular bacteria:

  • Immunofluorescence Microscopy:

    • Generate specific antibodies against recombinant RBE_0324

    • Validate antibody specificity using Western blot and knockout controls

    • Perform co-localization with known subcellular markers

    • Use super-resolution microscopy (STED, STORM) for precise localization

  • Fractionation Studies:

    • Develop protocols for bacterial fractionation from infected cells

    • Analyze RBE_0324 distribution across membrane, cytosolic, and septal fractions

    • Confirm fraction purity with established marker proteins

  • Fusion Protein Approaches:

    • Generate fluorescent protein fusions with RBE_0324

    • Express in model systems or, ideally, in R. bellii

    • Monitor localization in live cells across the bacterial life cycle

    • Validate that fusion doesn't disrupt normal localization

  • Electron Microscopy:

    • Perform immunogold labeling for RBE_0324

    • Use correlative light and electron microscopy for context

    • Examine distribution during different growth phases

  • Protease Accessibility:

    • Determine RBE_0324 orientation and exposure using protease protection assays

    • Identify membrane-protected versus exposed domains

These complementary approaches can provide a comprehensive understanding of where RBE_0324 functions within the bacterial cell and how its localization may change during the infection cycle.

What strategies should be employed to investigate post-translational modifications of RBE_0324?

Investigating post-translational modifications (PTMs) of RBE_0324 requires specialized analytical approaches:

  • Mass Spectrometry Analysis:

    • Purify native RBE_0324 from R. bellii if possible, or recombinant protein from expression systems

    • Perform tryptic digestion followed by LC-MS/MS analysis

    • Use different fragmentation methods (CID, ETD, HCD) to maximize PTM identification

    • Apply targeted approaches for specific modifications of interest

  • Modification-Specific Detection:

    • Use phospho-specific antibodies for phosphorylation detection

    • Apply Pro-Q Diamond staining for phosphorylation

    • Use click chemistry approaches for detecting glycosylation or lipidation

  • Site-Directed Mutagenesis:

    • Mutate predicted modification sites to non-modifiable residues

    • Assess functional consequences of preventing modification

    • Create phosphomimetic mutations (e.g., Ser to Asp) to mimic permanent modification

  • In Vitro Modification Assays:

    • Test susceptibility of recombinant RBE_0324 to relevant bacterial kinases, acetylases, etc.

    • Monitor modification stoichiometry under different conditions

  • Temporal Analysis:

    • Track modification status across different growth phases or infection stages

    • Correlate modifications with functional changes

These approaches should be implemented with appropriate controls, including unmodified recombinant protein references and internal standards for quantification when applicable.

What are the most promising future directions for research on RBE_0324?

Based on current knowledge about RBE_0324 and the broader context of R. bellii biology, several promising research directions emerge:

  • Structural Biology - Determining the three-dimensional structure of RBE_0324 would provide crucial insights into its function and potential interaction surfaces. This could reveal mechanistic details about its role in intracellular septation.

  • Host-Pathogen Interface - Investigating whether RBE_0324 interacts with tick or mammalian host factors could reveal its potential role in the unique adaptation of R. bellii to its arthropod hosts across different geographical regions .

  • Comparative Functional Analysis - Comparing the function of RBE_0324 homologs from North and South American R. bellii lineages may reveal adaptations to different tick vector species .

  • Systems Biology Approach - Integrating RBE_0324 into the broader protein interaction network of R. bellii, particularly focusing on its potential connections to the numerous ankyrin repeat and tetratricopeptide repeat proteins .

  • Evolutionary Analysis - Investigating the evolutionary trajectory of RBE_0324 may provide insights into the divergence of R. bellii from other rickettsial groups and adaptation to various tick hosts.

  • Therapeutic Target Assessment - Evaluating whether RBE_0324's role in septation could be exploited for development of novel anti-rickettsial approaches.

These directions build upon the established knowledge while addressing significant gaps in our understanding of this protein's biological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.