Recombinant Rickettsia bellii Protein-export membrane protein SecG (secG)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please include any such preferences in your order notes, and we will do our best to fulfill them.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All protein shipments are standardly sent with blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference for your own preparations.
Shelf Life
The shelf life of our proteins is influenced by several factors, including storage conditions, buffer composition, temperature, and inherent protein stability.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. Lyophilized protein, however, has a longer shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The specific tag type will be determined during the manufacturing process.
We strive to incorporate the tag type you specify. If you have a particular tag preference, please let us know, and we will prioritize its inclusion during development.
Synonyms
secG; RBE_1346; Protein-export membrane protein SecG
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Rickettsia bellii (strain RML369-C)
Target Names
secG
Target Protein Sequence
MLDILLFVHITIAILLIIVILMQRSGSDGISSISGGGNMGVISAKTANNFLTKSTVILAS LFLINAIILANLSSQKKPDLVSKINEIEENQVDNSLPIAK
Uniprot No.

Target Background

Function
SecG, a protein-export membrane protein, plays a critical role in protein export. It participates in an early stage of protein translocation, facilitating the movement of proteins across cellular membranes.
Database Links

KEGG: rbe:RBE_1346

Protein Families
SecG family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Rickettsia bellii and how does it differ from pathogenic Rickettsia species?

Rickettsia bellii is a member of the genus Rickettsia that has been isolated from ticks but is generally considered a nonpathogenic endosymbiont, unlike virulent species such as R. rickettsii which causes Rocky Mountain spotted fever. R. bellii has been found to coexist with other Rickettsia species in tick vectors like Dermacentor variabilis . Studies assessing its pathogenicity in guinea pig models have classified it among presumed endosymbionts rather than virulent pathogens . The genomic and phenotypic characteristics of R. bellii make it an important comparator for understanding what differentiates pathogenic from nonpathogenic rickettsial species.

What are optimal storage conditions for recombinant R. bellii SecG protein preparations?

Based on manufacturer recommendations for recombinant R. bellii SecG protein, optimal storage conditions include:

  • Short-term storage (up to one week): 4°C in working aliquots

  • Long-term storage: -20°C

  • Extended storage: -80°C

  • Storage buffer: Tris-based buffer with 50% glycerol, optimized for protein stability

Repeated freeze-thaw cycles should be avoided to maintain protein integrity. The use of glycerol in the storage buffer helps prevent protein denaturation during freeze-thaw cycles and maintains protein solubility.

What molecular techniques are effective for detecting R. bellii in environmental or clinical samples?

Several effective molecular detection methods have been validated for R. bellii identification:

  • 17-kDa surface antigen seminested PCR: This approach provides high sensitivity and specificity for detecting Rickettsia species in arthropod hosts. Studies have shown this gene has higher nucleotide substitution rates than 16S rRNA, making it valuable for species discrimination .

  • Citrate synthase gene analysis: Complementary to 17-kDa antigen detection, citrate synthase gene sequencing can confirm Rickettsia species identification. For R. bellii specifically, dedicated primer sets may be required as its sequence can be sufficiently divergent from other Rickettsia species .

  • Cloning and sequencing: When multiple Rickettsia species are suspected in a single sample, vector cloning followed by colony sequencing has proven effective in identifying co-infections, as demonstrated in studies detecting R. bellii alongside R. montanensis and R. rickettsii in individual ticks .

How can recombinant expression systems be used to study R. bellii membrane proteins?

Transformation systems have been successfully developed for rickettsial species that can provide insights into membrane protein function:

  • Shuttle vector transformation: R. bellii has been successfully transformed using plasmid shuttle vectors carrying spectinomycin resistance and GFPuv reporter genes . This approach could be adapted to study SecG by:

    • Creating expression constructs with tags for protein detection

    • Introducing modified versions of the secG gene to assess functional consequences

    • Complementing secG mutations to confirm phenotypes

  • Heterologous expression: Studies have demonstrated successful expression of heterologous genes in R. bellii, such as R. monacensis-derived rickA . This suggests that expression of modified or tagged SecG proteins from other species could be achieved in R. bellii.

  • Purification methodology: For membrane proteins like SecG, cell lysis using silicon carbide abrasive followed by filtration and centrifugation at 13,600 × g (4°C) has proven effective in rickettsial studies .

What is the significance of R. bellii co-infection with other Rickettsia species and how might SecG contribute to this phenomenon?

Research has documented natural superinfection of arthropods with multiple Rickettsia species, including R. bellii, R. montanensis, and R. rickettsii in a single tick . This phenomenon has important implications:

  • Ecological significance: The co-existence of multiple Rickettsia species suggests potential interactions between different rickettsial membrane systems that might involve SecG-mediated protein transport.

  • Research importance: The occurrence of multiple rickettsiae in a single tick has implications for understanding rickettsial transmission dynamics, the ecology of diseases like Rocky Mountain spotted fever, and the potential for human acquisition of several rickettsial species simultaneously .

  • Methodological considerations: When studying SecG in naturally occurring R. bellii, researchers should consider the possibility of co-infections that might complicate protein isolation or functional studies.

What controls should be included when working with recombinant R. bellii SecG protein?

For rigorous experimental design involving R. bellii SecG protein, the following controls should be considered:

  • Negative controls:

    • Buffer-only controls for binding studies

    • Transformed R. bellii with empty vectors (e.g., pRAM18dSGA[MCS] as used in comparative studies)

    • Non-SecG membrane proteins of similar size/structure

  • Positive controls:

    • Known SecG-interacting proteins from well-characterized bacterial systems

    • Confirmed SecG-dependent transport substrates

  • Validation methods:

    • Quantitative PCR to confirm expression levels of native versus recombinant secG

    • Antibody-based detection to verify protein production and localization

    • Functional assays to assess protein transport efficiency

How can researchers assess the functional activity of recombinant R. bellii SecG protein?

The functional assessment of SecG activity requires specialized approaches due to its role in protein transport:

  • In vitro translocation assays: Reconstituted membrane systems containing purified SecG can be tested for their ability to transport known Sec-dependent substrates.

  • Comparative phenotypic analysis: Similar to studies analyzing transformed R. bellii with heterologous genes , researchers can compare:

    • Growth characteristics

    • Cell infection capabilities

    • Protein secretion profiles

  • Genetic complementation: Testing whether R. bellii SecG can functionally replace SecG in other bacterial systems provides insights into conserved functions and species-specific adaptations.

What are common challenges in working with membrane proteins like R. bellii SecG and how can they be addressed?

Membrane proteins present specific technical challenges that researchers should anticipate:

ChallengeTechnical SolutionApplied Example
Limited solubilityUse of specialized detergents or amphipolsTris-based buffer with 50% glycerol optimization
Maintaining native conformationIncorporation into nanodiscs or liposomesPreservation of functional activity during storage at -20°C
Low expression yieldsCodon optimization and specialized expression systemsSilicon carbide abrasive cell lysis techniques used in rickettsial studies
Functional assessmentDevelopment of in vitro activity assaysComparative phenotypic analyses as demonstrated in rickettsial transformation studies
Purification complexityAffinity tags and optimized chromatographyMultiple centrifugation washing steps at 13,600 × g

How can potential experimental artifacts be distinguished from genuine effects when studying R. bellii SecG?

When investigating R. bellii SecG, several approaches can help differentiate artifacts from true biological effects:

  • Multiple detection methods: Employing both genetic (PCR-based) and protein-level (antibody-based) detection systems, as demonstrated in studies using both 17-kDa and citrate synthase gene analyses .

  • Replication across systems: Testing hypotheses in both recombinant expression systems and native contexts, comparing results between transformed and wild-type R. bellii .

  • Dose-response relationships: Establishing quantitative relationships between SecG levels and observed phenotypes, similar to the observed differential expression of heterologous genes in transformed R. bellii .

  • Statistical rigor: Implementing appropriate statistical analyses across multiple biological replicates, as exemplified in rickettsial detection studies that employed seminested PCR with appropriate negative controls .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.