Recombinant Rickettsia bellii Protein translocase subunit SecD (secD)

Shipped with Ice Packs
In Stock

Description

Introduction to Rickettsia bellii and Protein Secretion Systems

Rickettsia bellii is an obligate intracellular bacterium belonging to the spotted fever group (SFG) of rickettsiae. It is one of the most basal members of the genus Rickettsia and possesses the largest genome among known rickettsial species . R. bellii is particularly notable for its genetic distinctiveness, harboring a complete set of conjugative transfer genes and exhibiting pili-like structures that are unusual among rickettsiae . Unlike many of its pathogenic relatives, R. bellii can replicate in various host cell types, including tick cell lines (ISE6), monkey cell lines (Vero), and mouse cell lines (L929), with a doubling time of approximately 8 hours during exponential growth phase .

Protein secretion systems are vital for bacterial survival, particularly in obligate intracellular bacteria like Rickettsia species that must interact extensively with host cells. Among these systems, the Sec (secretion) pathway stands as one of the most evolutionarily conserved and functionally essential translocation mechanisms in prokaryotes, responsible for moving proteins across the bacterial inner membrane .

The Sec Translocase System in Bacteria

The bacterial Sec pathway consists of multiple components working in concert to identify, target, and translocate proteins across the inner membrane. In Rickettsia species, as in other bacteria, the Sec translocon anchors in the bacterial inner membrane and comprises both inner membrane and cytosolic sections that interact with secretory proteins .

The core components of the Sec pathway include:

  1. SecYEG: Forms the channel through which proteins pass

  2. SecA: An ATPase that provides energy for translocation

  3. SecB: A chaperone that binds unfolded polypeptides

  4. SecDF complex: Regulates secretion into the periplasm

The Sec pathway operates through two main mechanisms for protein export:

Co-translational Translocation (CTT)

In this pathway, hydrophobic signal sequences of nascent polypeptides are recognized by the signal recognition particle (SRP), which targets the ribosome-nascent chain complex to the Sec translocon while translation is ongoing .

Post-translational Translocation (PTT)

For less hydrophobic polypeptides, translation completes in the cytoplasm, and the unfolded polypeptide binds to the SecB chaperone. This complex is then targeted to the SecA ATPase, which uses energy from ATP hydrolysis to thread the substrate through the SecYEG channel .

The SecDF complex, which includes the SecD protein, plays a regulatory role in this process, particularly in the later stages of translocation into the periplasm .

Production Methodology

While the exact production methodology for this specific recombinant protein is not detailed in the search results, recombinant bacterial membrane proteins like SecD are typically produced through heterologous expression systems. These may include:

  1. Expression in E. coli using specialized vectors

  2. Purification through affinity chromatography using tags attached to the recombinant protein

  3. Validation of structure and function through various biochemical and biophysical techniques

The recombinant R. bellii SecD protein is likely produced with consideration for maintaining proper folding and functionality, particularly given the challenges associated with membrane protein expression .

Functional Role of SecD in Protein Translocation

The SecD protein functions as part of the SecDF complex, which plays a critical role in the later stages of protein translocation through the bacterial Sec pathway.

SecDF Complex Function

The SecDF complex, consisting of SecD and SecF proteins, likely regulates secretion of proteins into the periplasm in several ways:

  1. Facilitating the final stages of protein translocation through the SecYEG channel

  2. Preventing backsliding of partially translocated proteins

  3. Helping to release translocated proteins into the periplasm

  4. Potentially coupling proton motive force to assist in protein transport

Evidence for SecD Function in Rickettsia

While direct experimental evidence for R. bellii SecD function is limited in the search results, functional studies of the Sec pathway in related Rickettsia species provide insights:

  1. Transcriptional analysis in R. typhi determined that Sec pathway genes are highly expressed during infection, suggesting their importance

  2. A genome-wide screen for Sec substrates in R. typhi demonstrated a functional Sec pathway in Rickettsia species

  3. Complementation studies with chimeric SecA constructs (combining R. rickettsii and E. coli domains) restored function in E. coli, implying that Rickettsia Sec proteins are functional but with species-specific domains

These findings suggest that the Sec pathway, including the SecDF complex, is functional and important in obligate intracellular Rickettsia species, including R. bellii .

Importance of SecD in Rickettsia Biology and Pathogenesis

The Sec translocation pathway is essential for bacterial viability across species, as it facilitates the export of numerous proteins crucial for cell envelope integrity, nutrient acquisition, and host-pathogen interactions.

Potential Substrates of the Sec Pathway in R. bellii

The Sec pathway in Rickettsia species is responsible for the translocation of various proteins, including:

  1. Surface cell antigen (Sca) proteins: Many Sca proteins belong to the family of autotransporters (also known as type V secretion system) that depend on the Sec pathway for initial transport across the inner membrane

  2. Virulence factors: Proteins involved in host cell adhesion, invasion, and manipulation

  3. Membrane proteins: Components necessary for cell envelope maintenance and cellular processes

In particular, the Sca proteins, which contribute significantly to adherence and invasion of host cells by rickettsiae, rely on the Sec pathway for their translocation across the inner membrane before completing their transport to the bacterial surface .

Role in Growth and Replication

Given that R. bellii can replicate in various host cells with a doubling time of approximately 8 hours during exponential growth phase , efficient protein secretion through the Sec pathway is likely crucial for maintaining this growth rate. The SecD protein, as part of the SecDF complex regulating secretion into the periplasm, would play an important role in this process.

Research Applications of Recombinant R. bellii SecD

Recombinant Rickettsia bellii Protein translocase subunit SecD has several potential research applications:

Immunological Studies

The recombinant protein can be used as an antigen in the development of:

  1. Antibodies for research, diagnostic, or therapeutic purposes

  2. ELISA-based detection systems for Rickettsia infections

  3. Immunization studies to explore potential vaccine candidates

Inhibitor Development

As a critical component of a essential bacterial pathway, SecD represents a potential target for:

  1. Screening of small molecule inhibitors as potential antibacterial compounds

  2. Structure-based drug design aimed at disrupting protein translocation

  3. Development of novel therapeutics against rickettsial infections

Comparative Studies

Recombinant R. bellii SecD facilitates:

  1. Comparison with SecD proteins from other Rickettsia species to understand evolutionary adaptations

  2. Investigation of species-specific differences in protein translocation mechanisms

  3. Studies on the adaptations of the Sec pathway in obligate intracellular bacteria

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order notes. We will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Please note: All protein shipments are standardly packed with blue ice packs. If you require dry ice shipment, please communicate this to us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our proteins depends on several factors, including storage conditions, buffer composition, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid protein is 6 months at -20°C/-80°C. The shelf life of lyophilized protein is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preferred tag type, please inform us, and we will prioritize the development of the specified tag.
Synonyms
secD; RBE_0700; Protein translocase subunit SecD
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-514
Protein Length
full length protein
Species
Rickettsia bellii (strain RML369-C)
Target Names
secD
Target Protein Sequence
MQNLPKWKIFLSIICTIFAVICALPNFTQVKSKYLPHDSVNLGLDLRGGAHLLLDVDFDT YLNDTMENLADTLRKSFREDKIGYKNLLVKQNNIQLELRSQEELKPLKRIISKIDPEINV EANDNRIKLSYSESRLSELLNKVVDQSIEIVRMRVDSTGTKEPILQKQGDRHILLQVPGE EDPTYLKNILGKTAKLIFHLVDENANVEEAVKGHVPMGSMLVQGDRMGYLVVKKKAILGG DSLTTAAASFDQNSQAVVSFSFNSLGSKLFGEVTKNNVGKHLAIVLDNKLLSAPTINQPI MGGSGIISGDFTVESANELALLLRAGSLPAPLKIIEERSIGPNLGADSIESGKKAGIIGF AAVCIFMVWSYGLLGLFANIALSLAMLYVLALLSLFQATLTLPGIAGIILTMGMAVDANV LIYERIKEELNKGTSNLYAIKTGFESAFATILDSNLTTLIVAFLLYIFGVGAIKGFAVAL TIGIISSMFSAIIITKLLIDIWVKYFKPKKLGLV
Uniprot No.

Target Background

Function
SecD is a component of the Sec protein translocase complex, which facilitates the movement of proteins across the cell membrane. SecD interacts with the SecYEG preprotein conducting channel. It utilizes the proton motive force (PMF) to complete protein translocation after the ATP-dependent function of SecA.
Database Links

KEGG: rbe:RBE_0700

Protein Families
SecD/SecF family, SecD subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How conserved is the SecD protein sequence across different Rickettsia species?

Rickettsia bellii, which diverged early in rickettsial evolution, contains some unique genomic features compared to other pathogenic rickettsiae. These differences may extend to its SecD protein, potentially reflecting adaptations to its ecological niche. Stable transformation systems developed for R. bellii provide tools to investigate these potential functional differences .

What is known about the genetic organization of the secD locus in R. bellii?

The secD gene in R. bellii is typically arranged in an operon structure with secF, as is common in many bacterial species. This genetic organization facilitates the coordinated expression of these functionally related components. The secD-secF genes are generally constitutively expressed, reflecting their essential role in protein secretion under various conditions.

Analysis of the R. bellii genome reveals that the sec genes are part of the core genome, maintained despite the reductive evolution characteristic of obligate intracellular bacteria. The presence of plasmids in R. bellii, as demonstrated by Southern analysis, suggests potential for horizontal gene transfer that may influence secD expression or function under certain conditions .

What expression systems are most effective for producing recombinant R. bellii SecD protein?

  • Fusion protein strategies: Fusion with solubility-enhancing tags such as MBP (maltose-binding protein) or SUMO can improve folding and solubility.

  • Membrane protein-specific expression systems: E. coli strains optimized for membrane protein expression (e.g., C41(DE3), C43(DE3)) with temperature optimization (typically 16-20°C) often yield better results.

  • Cell-free expression systems: These can be particularly useful for producing difficult membrane proteins like SecD by allowing direct incorporation into liposomes or nanodiscs.

The table below summarizes typical expression conditions for rickettsial membrane proteins:

Expression SystemTemperatureInduction ConditionsAdvantagesChallenges
E. coli BL21(DE3)16°C0.1-0.5 mM IPTG, 16-18 hrsWidely availableLower yields for membrane proteins
E. coli C41(DE3)18°C0.1 mM IPTG, 20 hrsBetter for membrane proteinsMay require optimization
Cell-free systems30°Cn/aAvoids toxicity issuesHigher cost, lower yield
Insect cell expression27°CVaries by systemBetter folding of complex proteinsTechnically demanding

How can shuttle vectors be used to study SecD function in R. bellii?

Shuttle vectors represent a powerful tool for investigating SecD function in R. bellii. The development of plasmid-based transformation systems for Rickettsia species has created new opportunities for genetic manipulation of these historically challenging organisms . To study SecD using these systems:

  • Complementation studies: In cases where endogenous secD has been mutated or downregulated, wild-type or modified secD can be introduced via shuttle vectors to assess functional restoration.

  • Tagged protein expression: SecD can be expressed with epitope or fluorescent tags to monitor localization and protein interactions within the bacterial cell.

  • Controlled expression systems: Inducible promoters incorporated into shuttle vectors allow for regulated expression of SecD variants to examine phenotypic effects.

The shuttle vectors developed from R. amblyommii plasmids (pRAM18 and pRAM32) have been successfully used to transform diverse rickettsiae, including R. bellii, with stable maintenance of the vectors through multiple passages . These vectors typically maintain 2.6-13.3 copies per cell, depending on the Rickettsia species and the specific vector used .

What are the most reliable methods for analyzing protein-protein interactions involving SecD in Rickettsia?

Due to the challenges of working with obligate intracellular bacteria, several complementary approaches should be employed when studying SecD protein interactions:

  • Co-immunoprecipitation with tagged SecD, followed by mass spectrometry, can identify interaction partners. Similar approaches have been used successfully to identify interactions between rickettsial effectors and host proteins, such as the interaction between SrfD and the host Sec61 complex .

  • Bacterial two-hybrid systems adapted for membrane proteins can provide evidence for specific protein interactions in a heterologous system.

  • Cross-linking approaches, particularly those suitable for membrane proteins, can capture transient interactions within the native bacterial environment.

  • Split-GFP or FRET-based assays can be used to visualize interactions within transformed rickettsiae expressing fluorescently tagged proteins.

  • Proximity-dependent biotin labeling methods (BioID or APEX) can identify proteins in the vicinity of SecD in the native environment.

When investigating interactions with host proteins, techniques that preserve the context of infection are particularly valuable, as demonstrated in studies of rickettsial secreted effectors like SrfD .

How does SecD contribute to pathogenesis and host cell interaction in Rickettsia infections?

SecD likely plays an indirect but critical role in Rickettsia pathogenesis by facilitating the translocation of virulence factors that interact with host cells. While direct evidence for SecD's role in R. bellii pathogenesis is limited, research on related rickettsial species provides important insights:

  • Protein secretion systems are essential for delivering bacterial effectors into host cells, as demonstrated by the diverse set of novel effectors identified in R. parkeri that localize to different host cell compartments .

  • Secreted rickettsial factors (Srfs) interact with various host structures, including the cytoplasm, mitochondria, and endoplasmic reticulum. For example, SrfD interacts with the host Sec61 translocon at the ER .

  • The Sec system likely contributes to the secretion of outer membrane proteins involved in host cell attachment and invasion.

The role of SecD might be particularly important in R. bellii given its distinct evolutionary position within the Rickettsia genus and its maintenance of plasmids that potentially carry genes for host adaptation .

What experimental approaches are most effective for studying the role of SecD in protein secretion during Rickettsia infection?

Investigating SecD function during infection requires approaches that account for the intracellular lifestyle of rickettsiae:

  • Conditional expression/knockdown systems: Using inducible promoters to modulate SecD expression levels during infection can reveal its importance for bacterial survival and effector secretion.

  • Cell-selective proteomics: This approach has been successfully used to identify secreted effectors in R. parkeri and could be adapted to compare secretion profiles in wild-type versus SecD-modified rickettsiae.

  • Fluorescent protein fusions: Tagging SecD-dependent secreted proteins with fluorescent markers can enable real-time tracking of secretion during infection.

  • Host cell fractionation: Careful separation of bacterial and host cell compartments following infection can help identify SecD-dependent secreted proteins.

  • Comparative analysis of secreted proteomes: Comparison between wild-type R. bellii and strains with modified SecD can identify proteins dependent on SecD for secretion.

The challenge lies in distinguishing proteins secreted via the Sec pathway from those secreted through other systems, as rickettsiae possess multiple secretion mechanisms.

How do the functions of rickettsial SecD compare with the translocase systems of other intracellular bacterial pathogens?

Rickettsial SecD functions within the context of a highly specialized intracellular pathogen that has undergone reductive evolution. Comparative analysis reveals several important distinctions:

  • Reduced complement of secretion systems: Unlike many gram-negative pathogens, rickettsiae lack type III secretion systems and have a simplified type IV secretion system, potentially increasing their reliance on the Sec pathway.

  • Co-evolution with arthropod and mammalian hosts: The rickettsial Sec system may have adaptations specific to their unique dual-host lifecycle.

  • Plasmid-encoded factors: The presence of plasmids in many Rickettsia species, including R. bellii , suggests that horizontally acquired genes may interact with the core Sec machinery in species-specific ways.

  • Specialized effector repertoire: Rickettsia species secrete genus-specific effectors, such as those containing the Rickettsia-specific domains DUF5460 and DUF5410 , which may require specialized features of their Sec machinery.

Understanding these differences is critical for developing targeted approaches to studying SecD function in the context of rickettsial biology.

What technical challenges are commonly encountered when working with recombinant R. bellii SecD and how can they be addressed?

Researchers working with recombinant R. bellii SecD typically face several challenges:

How can genome editing approaches be used to study SecD function in Rickettsia bellii?

While genetic manipulation of rickettsiae has historically been challenging, recent advances offer several approaches for studying SecD:

  • Shuttle vector-based complementation: Using the plasmid-based shuttle vectors developed for rickettsiae , wild-type or mutant secD can be introduced to complement conditional mutations or for overexpression studies.

  • Transposon mutagenesis: Random transposon insertion libraries can potentially generate secD disruption mutants, though essential genes like secD may be underrepresented.

  • CRISPR-Cas9 adaptation: Though technically challenging in obligate intracellular bacteria, modified CRISPR systems could potentially be used for targeted editing of secD.

  • Conditional expression systems: Placing secD under an inducible promoter allows for controlled expression levels to study dosage effects on protein secretion.

  • Antisense RNA strategies: Expression of antisense RNA targeting secD mRNA can reduce expression levels without completely eliminating the gene.

The stable transformation of R. bellii using shuttle vectors derived from R. amblyommii plasmids provides a foundation for these genetic approaches .

What bioinformatic tools and resources are most valuable for analyzing R. bellii SecD in comparative genomic studies?

Several computational resources and approaches are particularly useful for studying SecD:

  • Specialized databases:

    • PATRIC (Pathosystems Resource Integration Center): Provides comprehensive genomic data for bacterial pathogens, including Rickettsia species

    • VectorBase: Contains genomic information about arthropod vectors that host Rickettsia

  • Analysis tools:

    • SignalP and TMHMM: For prediction of signal peptides and transmembrane helices in SecD

    • I-TASSER or AlphaFold: For protein structure prediction of SecD

    • CLANS or OrthoMCL: For analyzing evolutionary relationships between SecD proteins across bacterial species

  • Methodological approaches:

    • Synteny analysis: Examining gene neighborhood conservation around secD

    • Selection pressure analysis: Calculating dN/dS ratios to identify regions under selective pressure

    • Structural modeling: Predicting interaction surfaces and functional domains

  • Integrative analysis:

    • Combining transcriptomic data with genomic information to understand secD expression patterns

    • Correlating secD sequence variations with ecological niche or host range differences

These resources can help identify conserved and variable regions in SecD that may correlate with functional specialization across Rickettsia species.

How might novel transformation technologies advance our understanding of SecD function in R. bellii?

The development of shuttle vectors for transformation of diverse Rickettsia species represents a significant breakthrough that opens new avenues for SecD research . Future advances may include:

  • Inducible expression systems: Refinement of controlled gene expression tools would allow precise temporal regulation of SecD levels during infection.

  • Reporter fusions: Development of sensitive reporters for protein translocation would enable high-throughput screening of SecD variants or inhibitors.

  • Fluorescent protein tagging: Further optimization of fluorescent markers compatible with rickettsia biology could enable real-time visualization of SecD localization and dynamics.

  • CRISPR-based systems: Adaptation of CRISPR technology for rickettsiae would enable precise genome editing to study SecD function.

  • Single-cell analysis: Technologies that allow examination of SecD function in individual bacteria within host cells could reveal heterogeneity in secretion processes.

The successful transformation of multiple Rickettsia species with plasmid-based vectors maintaining 2.6-28.1 copies per cell provides a foundation for these future developments .

What is the potential relationship between SecD function and the rickettsial effector secretion system?

Recent research has identified novel rickettsial effectors secreted into host cells , raising important questions about the relationship between the Sec system and effector secretion:

  • The Sec system may function as the initial translocation step for effectors that are subsequently transported by specialized secretion systems.

  • Some rickettsial effectors might utilize the Sec pathway directly for secretion across the inner membrane before engaging other systems for outer membrane translocation.

  • The interaction between rickettsial effectors like SrfD and host proteins such as the Sec61 translocon suggests interesting parallels between bacterial and host translocation machinery that merit further investigation.

  • The presence of species-specific effectors with unique domains (e.g., DUF5460 and DUF5410 in R. parkeri) raises questions about potential adaptations in the SecD protein to accommodate these specialized substrates.

Understanding these relationships could provide insights into the evolution of rickettsial pathogenesis and host-pathogen interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.