Recombinant Rickettsia bellii Putative Na (+)/H (+) antiporter nhaA homolog

Shipped with Ice Packs
In Stock

Description

Functional and Biochemical Insights

  • Role in Ion Homeostasis: NhaA homologs mediate Na+^+/H+^+ exchange, critical for pH regulation and osmotic balance in intracellular bacteria . Rickettsia bellii relies on host-derived metabolites due to its reduced genome, making transporters like NhaA essential for survival .

  • Transcriptional Dynamics: The nhaA gene is constitutively expressed, but its activity may correlate with bacterial replication phases. In R. bellii, conjugative transfer (tra) genes exhibit upregulation during exponential growth in tick cells, suggesting coordinated regulation with metabolic genes .

Phylogenetic and Genomic Context

  • Evolutionary Divergence: R. bellii’s nhaA clusters within a basal rickettsial clade, distinct from pathogenic spotted fever and typhus groups . Phylogenetic analysis of 30 isolates revealed continental divergence, with North and South American strains forming separate clades .

  • Horizontal Gene Transfer: Genomic evidence suggests ancestral Rickettsia acquired nhaA-like genes via conjugation within amoebae, facilitated by tra genes retained in R. bellii . This is supported by the presence of sex pili and conjugation machinery in R. bellii .

Research Applications

  • ELISA Development: Recombinant NhaA is used in diagnostic kits (e.g., CSB-CF632210RAaI) to detect R. bellii in tick vectors, with 50 µg aliquots optimized for specificity .

  • Ion Transport Studies: Structural homology to Vibrio cholerae NhaA (a validated Na+^+/H+^+ antiporter) enables comparative studies on pH-dependent ion flux .

  • Vaccine Research: As a surface-exposed protein, NhaA is explored as a candidate antigen for anti-rickettsial vaccines .

Comparative Analysis of Recombinant NhaA Variants

SpeciesGene IDHost SystemPurityKey Application
Rickettsia belliiRBE_1418E. coli≥85% Ion transport assays, diagnostics
Rickettsia rickettsiinhaAE. coli≥85% Pathogenicity studies
Legionella pneumophilanhaAE. coli≥85% Comparative genomics

Challenges and Future Directions

  • Functional Validation: While in silico models predict NhaA’s role in pH balance, direct electrophysiological evidence is lacking.

  • Host Interactions: The interplay between R. bellii’s NhaA and tick host physiology remains uncharacterized, necessitating proteomic studies in vector models .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on your location and purchasing method. Please consult your local distributors for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. You may use this as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors such as storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development if possible.
Synonyms
nhaA; A1I_07885; Putative Na(+/H(+ antiporter NhaA homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Rickettsia bellii (strain OSU 85-389)
Target Names
nhaA
Target Protein Sequence
MVEAGIHGTLCGAIIALFIPVNIKGQINSSFHKLEKLIQPFVNYFILPLFVFMNSGVLLK DFSFRSVCSSLTFGIILGLFIGKQLGVMLFSYPCVKFNFCSLPSNTSWLKFYSIAILGGI GFTLSLFIGGITFEGGCPSNSMRVAVIIGSLLSALFGILVMRYCTKSK
Uniprot No.

Target Background

Database Links
Protein Families
NhaA Na(+)/H(+) (TC 2.A.33) antiporter family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Rickettsia bellii nhaA homolog?

The Rickettsia bellii putative Na(+)/H(+) antiporter nhaA homolog (nhaA) is a 132-amino acid membrane protein involved in sodium and proton exchange across bacterial membranes. It belongs to the Na(+)/H(+) antiporter family, which plays crucial roles in pH regulation, sodium homeostasis, and osmotic regulation in bacteria. The protein is encoded by the nhaA gene in R. bellii, an obligate intracellular bacterium that possesses a relatively complete genome compared to other rickettsial species .

Unlike many other rickettsial species with reduced genomes, R. bellii retains several important gene sets, including a complete set of conjugative transfer (tra) genes, which suggests a greater genetic plasticity and potentially more complex physiological capabilities . The nhaA homolog in R. bellii likely contributes to its ability to survive in varying host environments.

How does R. bellii nhaA compare to Na(+)/H(+) antiporters in other bacterial species?

The phylogenetic positioning of R. bellii is also noteworthy. R. bellii shows signs of potential recombination events with other Rickettsia species, as observed in studies comparing R. bellii and R. limoniae in Macrolophus bugs . This genetic exchange capability may have implications for the evolution of functional genes like nhaA.

What expression systems are suitable for recombinant R. bellii nhaA production?

Based on successful production strategies, E. coli represents the preferred expression system for recombinant R. bellii nhaA protein. When expressing membrane proteins like nhaA, several considerations should be addressed:

  • Vector selection: Vectors with strong, inducible promoters and appropriate tags (such as His-tags) facilitate protein expression and subsequent purification.

  • E. coli strain optimization: BL21(DE3) or its derivatives are often suitable for membrane protein expression. The recombinant R. bellii nhaA protein has been successfully expressed in E. coli systems .

  • Induction conditions: Optimization of temperature, inducer concentration, and induction time is critical. Lower temperatures (16-25°C) often improve membrane protein folding.

  • Membrane fraction isolation: Specialized protocols for membrane protein extraction should be employed, including appropriate detergents for solubilization.

Researchers should consider that membrane proteins like nhaA often present challenges in expression and purification due to their hydrophobic nature and potential toxicity to host cells when overexpressed.

How should recombinant R. bellii nhaA protein be stored and reconstituted?

Proper storage and reconstitution of recombinant R. bellii nhaA protein is critical for maintaining its structural integrity and functional activity:

Storage recommendations:

  • Store lyophilized protein at -20°C/-80°C upon receipt

  • Aliquot reconstituted protein to avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

  • Avoid repeated freezing and thawing as this can compromise protein structure and function

Reconstitution protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (optimally 50%) for long-term storage

  • Store reconstituted protein in Tris/PBS-based buffer with 6% Trehalose at pH 8.0

These guidelines ensure maximum stability and activity of the recombinant protein for experimental applications.

What are the optimal conditions for studying R. bellii growth in laboratory settings?

R. bellii, as an obligate intracellular bacterium, requires host cells for propagation. Research has established several optimal conditions for R. bellii culture:

Host cell lines:

  • Tick cell line ISE6 (derived from Ixodes scapularis embryos)

  • Mammalian cell lines: Vero (monkey kidney) and L929 (mouse fibroblast)

Culture conditions:

  • Temperature: 34°C is optimal for growth in tick cell lines

  • Growth dynamics: R. bellii exhibits a doubling time of approximately 8 hours during the period of 36 to 60 hours post-inoculation (HPI)

  • Quantification: Rickettsial growth can be monitored by quantifying gltA gene copy numbers using qPCR

Growth pattern data:

TimeMethodMean Copy NumberStandard Error
12 HPIRickettsiae preparation (RP)4.01×10⁷6.98×10⁶
12 HPIWhole cell (WC)3.77×10⁷1.05×10⁷
72 HPIRickettsiae preparation (RP)3.72×10⁹2.04×10⁸
72 HPIWhole cell (WC)4.13×10⁹2.62×10⁸

No significant difference was observed between rickettsiae prepared by semi-purification (RP) and whole cell lysis (WC) methods (p>0.05), indicating researchers can use either approach for quantification .

How can reference genes be selected for transcriptional analysis of R. bellii genes?

Selection of appropriate reference genes is critical for accurate transcriptional analysis of R. bellii genes, including nhaA. Based on systematic evaluation, the following approach is recommended:

  • Candidate reference gene selection:

    • Select genes from different metabolic pathways

    • Focus on housekeeping genes with predicted stable expression

    • Consider genes previously shown to have transcription levels above background

  • Validated reference genes for R. bellii:

    • methionyl tRNA ligase (metG) has been identified as the most stable reference gene

    • A combination of metG and ribonucleoside diphosphate reductase 2 subunit beta (nrdF) provides optimal normalization

    • Other tested genes included 16S rRNA, atpB, dnaK, gltA, gyrA, infB, rpoB, and tlc5

  • Validation methods:

    • Employ statistical algorithms from different programs such as Normfinder and BestKeeper

    • Test stability across different time points (12, 24, 36, 48, and 72 HPI)

    • Verify consistency across different host cell types

  • qRT-PCR methodology:

    • Use two-step qRT-PCR with sample maximization

    • Synthesize first-strand cDNA using random hexamer primers

    • Dilute cDNA 1:20 with water for qPCR reactions

This approach ensures reliable normalization of expression data for R. bellii genes under various experimental conditions .

What is the relationship between nhaA expression and R. bellii's adaptation to different host cells?

The expression of nhaA in R. bellii exhibits host cell-dependent variation, suggesting its role in adaptation to different cellular environments. Transcriptional analysis has shown differential expression patterns of R. bellii genes depending on the host cell type:

In tick versus mammalian cells:

  • Some R. bellii genes, like traA (a conjugative transfer gene), show up-regulation at 72 hours post-inoculation specifically in the tick cell line ISE6

  • No apparent expression changes are observed in mammalian cell lines (Vero and L929)

While direct data on nhaA expression across different host cells is limited, the observed host-specific regulation of other R. bellii genes suggests that nhaA may also be differentially regulated. This pattern aligns with the broader understanding that Na(+)/H(+) antiporters play crucial roles in bacterial adaptation to varying environmental conditions, including differences in pH and ion concentrations that might exist between arthropod and mammalian host cells.

The investigation of nhaA expression in relation to host adaptation would benefit from similar transcriptional analysis approaches used for other R. bellii genes, applying the validated reference genes (metG or metG/nrdF combination) for accurate normalization .

How does the genetic recombination capability of R. bellii affect nhaA gene evolution?

R. bellii demonstrates significant potential for genetic recombination, which may influence the evolution of functional genes like nhaA:

  • Genomic evidence of recombination:

    • R. bellii possesses a complete set of conjugative transfer (tra) genes, which are rare in rickettsial species with more reduced genomes

    • Phylogenetic analysis of R. bellii shows clustering patterns that suggest recombination events between different Rickettsia species

  • Implications for nhaA evolution:

    • Recombination events play an important role in rickettsial evolution, enabling adaptation to new hosts

    • In studies of R. bellii from Macrolophus bugs, evidence suggests recombination between R. bellii and R. limoniae

    • R. bellii clusters with the bellii group based on CoxA and GltA genes, but shows similarity to the R. limoniae group according to 16S rRNA gene phylogeny, indicating possible recombination

  • Functional consequences:

    • Genetic recombination can lead to functional diversification of genes like nhaA

    • Such diversification may contribute to adaptations to different hosts and environmental conditions

    • The functional integrity of genes can be maintained despite genomic reduction through selective pressure

The combination of R. bellii's relatively complete genome and its recombination capabilities suggests that its nhaA gene may be more prone to evolutionary innovation compared to antiporter genes in other rickettsial species with more reduced genomes.

What methods are most effective for functional characterization of R. bellii nhaA?

Functional characterization of R. bellii nhaA requires specialized approaches due to its nature as a membrane transporter and the challenges of working with rickettsial proteins:

  • Heterologous expression systems:

    • Express R. bellii nhaA in antiporter-deficient E. coli strains (e.g., E. coli HITΔAB⁻)

    • Complement growth defects under high Na⁺ or alkaline conditions

    • Similar approaches have been successful with other bacterial Na⁺/H⁺ antiporters, such as those from V. cholerae

  • Transport activity assays:

    • Measure Na⁺/H⁺ exchange in everted membrane vesicles

    • Use acridine orange fluorescence quenching to monitor pH gradient dissipation

    • Employ ²²Na⁺ uptake assays in reconstituted proteoliposomes

  • Mutagenesis studies:

    • Generate site-directed mutants targeting conserved residues

    • Create chimeric proteins with well-characterized antiporters

    • Analyze the effects on transport kinetics and ion specificity

  • Protein localization and topology:

    • Use GFP fusions or immunolocalization to confirm membrane localization

    • Employ cysteine accessibility methods to determine transmembrane topology

    • Validate findings through bioinformatic predictions of membrane-spanning domains

  • Transcriptional analysis:

    • Apply validated reference genes (metG or metG/nrdF) for accurate qRT-PCR normalization

    • Monitor expression across different growth conditions and host cell types

    • Compare with expression patterns of other transport-related genes

These methodological approaches provide complementary data on nhaA function, contributing to a comprehensive understanding of its physiological role in R. bellii.

How can researchers address common challenges in R. bellii culture and protein expression?

Working with R. bellii and expressing its proteins present several challenges that researchers can address using optimized protocols:

Challenge 1: Maintaining viable R. bellii cultures

  • Solution: Monitor growth using qPCR targeting the gltA gene

  • Both rickettsiae prepared by semi-purification (RP) and whole cell lysis (WC) methods yield reliable quantification results

  • Maintain cultures at 34°C in appropriate host cells (ISE6 for tick cells, Vero or L929 for mammalian cells)

Challenge 2: Optimizing recombinant protein expression

  • Solution: For membrane proteins like nhaA, express as His-tagged constructs in E. coli

  • Use appropriate codon optimization for E. coli expression

  • Consider fusion partners that enhance solubility

  • Express at lower temperatures (16-25°C) to improve protein folding

Challenge 3: Protein degradation during purification

  • Solution: Include protease inhibitors throughout purification

  • Work at 4°C when possible

  • Add glycerol (5-50%) to storage buffers

  • Store in appropriate buffer (Tris/PBS-based with 6% Trehalose, pH 8.0)

Challenge 4: Inconsistent gene expression data

  • Solution: Use validated reference genes (metG or metG/nrdF combination)

  • Apply statistical algorithms (Normfinder, BestKeeper) to verify reference gene stability

  • Test multiple time points to capture dynamic expression patterns

How should researchers interpret contradictory results in R. bellii nhaA functional studies?

Contradictory results in functional studies of R. bellii nhaA may arise from several sources and require systematic investigation:

When contradictory results emerge, researchers should systematically examine these factors and consider the possibility that seemingly contradictory findings might reflect the complex biology of R. bellii and its adaptations to different environments.

What bioinformatic approaches are recommended for analyzing R. bellii nhaA sequence and structure?

Comprehensive bioinformatic analysis of R. bellii nhaA should include:

  • Sequence analysis tools:

    • BLAST for homology searches against other bacterial Na⁺/H⁺ antiporters

    • Multiple sequence alignment (Clustal Omega, MUSCLE) to identify conserved residues

    • Phylogenetic analysis (MEGA, PhyML) to determine evolutionary relationships with other antiporters

  • Structural prediction:

    • Transmembrane domain prediction (TMHMM, Phobius)

    • Protein folding prediction (I-TASSER, AlphaFold)

    • Molecular dynamics simulations to model ion transport mechanism

  • Functional site prediction:

    • Identification of ion binding residues (ConSurf, MEME)

    • Active site and substrate specificity prediction

    • Analysis of protein-protein interaction motifs

  • Comparative genomics:

    • Analysis of genomic context of nhaA in R. bellii

    • Comparison with nhaA homologs in other rickettsial species

    • Investigation of potential recombination events using programs like RDP4 or Recombination Analysis Tool (RAT)

  • Transcriptomic data analysis:

    • Analysis of nhaA expression using validated reference genes (metG or metG/nrdF)

    • Comparison of expression patterns across different conditions

    • Integration with other omics data to understand regulation networks

These bioinformatic approaches provide a foundation for understanding the structure-function relationship of R. bellii nhaA and its evolutionary context within bacterial Na⁺/H⁺ antiporters.

What are the most promising areas for future research on R. bellii nhaA?

Several high-priority research directions would significantly advance understanding of R. bellii nhaA:

  • Functional genomics approaches:

    • Gene knockout or knockdown studies to determine the essentiality of nhaA

    • Complementation studies in nhaA-deficient bacterial strains

    • CRISPR-Cas9 based genome editing to introduce specific mutations

  • Host-pathogen interaction studies:

    • Investigation of nhaA's role in R. bellii adaptation to diverse host environments

    • Analysis of nhaA expression during host cell infection and replication

    • Determination of how nhaA activity affects rickettsial fitness in different hosts

  • Structural biology:

    • Crystallography or cryo-EM studies of R. bellii nhaA structure

    • Conformational changes during ion transport

    • Comparison with better-characterized bacterial antiporters

  • Systems biology integration:

    • Incorporation of nhaA function into metabolic models of R. bellii

    • Network analysis of nhaA interactions with other rickettsial proteins

    • Multi-omics approaches to understand regulatory networks

These research directions would contribute to a comprehensive understanding of nhaA's role in R. bellii physiology and potentially reveal new insights into bacterial adaptation strategies.

How might R. bellii nhaA research contribute to broader scientific understanding?

Research on R. bellii nhaA has implications that extend beyond rickettsial biology:

  • Evolutionary biology insights:

    • Understanding how intracellular bacteria maintain ion homeostasis

    • Insights into the evolution of membrane transporters during genome reduction

    • Evidence for the role of horizontal gene transfer in bacterial adaptation

  • Membrane transport mechanisms:

    • Novel structural or functional features of Na⁺/H⁺ antiporters

    • Adaptations of ion transport mechanisms in obligate intracellular bacteria

    • Comparative insights with better-characterized antiporters like those from V. cholerae

  • Host-pathogen interactions:

    • Role of ion transport in bacterial survival within eukaryotic cells

    • Adaptation to different host cell environments (arthropod vs. mammalian)

    • Potential targets for controlling rickettsial infections

  • Biotechnological applications:

    • Engineering of bacterial antiporters for biotechnological applications

    • Development of expression systems optimized for membrane proteins

    • Applications in synthetic biology and metabolic engineering

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.