Recombinant Rickettsia bellii Putative sensor histidine kinase ntrY-like (RBE_0470)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Rickettsia bellii Putative Sensor Histidine Kinase NtrY-Like (RBE_0470) is a full-length, His-tagged protein expressed in Escherichia coli (E. coli). It belongs to the histidine kinase family and is part of a two-component regulatory system (RBE_0470/RBE_0312) in Rickettsia bellii, a basal group of intracellular bacteria associated with ticks . The protein spans 610 amino acids (UniProt ID: Q1RJB3) and is inferred to play a role in environmental signal transduction via phosphorelay activity .

PropertyDetails
SpeciesRickettsia bellii
SourceRecombinant expression in E. coli
TagN-terminal His tag
Protein LengthFull-length (1-610 amino acids)
Molecular FunctionATP binding (GO:0005524); phosphorelay sensor kinase activity (GO:0000155)
Cellular LocationIntegral component of the plasma membrane (GO:0016021, GO:0005886)

Production and Purification

The recombinant protein is produced in E. coli and purified using affinity chromatography. Key specifications include:

ParameterDetails
Purity>90% (verified by SDS-PAGE)
FormLyophilized powder in Tris/PBS buffer (pH 8.0) with 6% trehalose
ReconstitutionRecommended in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for stability
Storage-20°C/-80°C; avoid repeated freeze-thaw cycles

4.1. Role in Rickettsia bellii Biology

  • Two-component systems: RBE_0470 interacts with the response regulator RBE_0312 to modulate gene expression in response to environmental stimuli, such as nutrient availability or stress .

  • Evolutionary significance: R. bellii’s genome encodes ancestral traits shared with amoebae, suggesting horizontal gene transfer events that influenced its adaptation to intracellular niches .

4.2. Phylogenetic Insights

A 2018 phylogeographic study analyzed 30 R. bellii isolates from North and South America using concatenated sequences of gltA, atpA, and coxA genes. Key findings:

  • Geographic divergence: North and South American isolates formed distinct clades, with limited genetic mixing .

  • Host-specific adaptation: Clades correlated with tick host species (e.g., Dermacentor variabilis in North America; Amblyomma spp. in South America) .

Comparative Analysis with Other Rickettsial Kinases

SpeciesProteinFunctionHost Reactivity
R. conoriiRC0948Histidine kinaseBroad-spectrum antibody cross-reactivity
R. typhiRT0603Two-component sensor kinaseExpressed in E. coli/yeast systems
R. felisRF_0427Signal transductionUsed in structural studies

Future Directions

  • Structural studies: Cryo-EM or X-ray crystallography could elucidate the kinase’s conformational changes during phosphotransfer.

  • Drug discovery: Targeting RBE_0470’s ATP-binding domain may offer avenues for anti-rickettsial therapies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
RBE_0470; Putative sensor histidine kinase NtrY-like
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-610
Protein Length
full length protein
Species
Rickettsia bellii (strain RML369-C)
Target Names
RBE_0470
Target Protein Sequence
MPKLKIFLFKYLYSKRFIGILVAIAIIFSYFTYYTISIGTKNGAVNSSKVIWFLLIDLII FLVLGILLTRKFFQSFFFKNSDQNTSKLQNRIVVAFSLAAAIPTIIVSISSAYFLNLSIQ AWFDRKISVVLDQSIMVADSYIAEHKVLLRETALAVAEDLSDMYYDLIHNPALFTKTLNT EAEMRSLDEAIVLNKSTNTIIANSYLSFSLSFATIPAHLIKKADSCEPVEVKSDPTKIRM LIKLKEYNDVYLLVGRSIDNKIIDHIDATNGAAAEYHRLKNQIGNIQIKFSIIFIFIALL LLLIAISFGVIVTAKIVNPIKKLVIATDKVKSGDLTVQVPENEVDKDEIGTLYAAFNRMI KQLSRQQRDLVIAQRALAWSDVAKKVAHEIKNPLTPILLASERLLKKFSPEIKERAEFEN YLKMIIRHTNDIKNIVSEFVLFARLPAPKFTNCDLIYVINNIVEARKLLNNNILYSFETN IDQFDFTCDTTQINQVMINLLKNAEESLEGSNQAAIKVNINTSEQFINITVLDNGRGFPP ELIGKATESYVTTRSKGMGVGLAIVKRIVEEHCGVLDIANRETGGAVIDIRFNLEELKLK VKRHEIGVIS
Uniprot No.

Target Background

Function
This protein is a member of the two-component regulatory system RBE_0470/RBE_0312.
Database Links

KEGG: rbe:RBE_0470

Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Rickettsia bellii Putative sensor histidine kinase ntrY-like (RBE_0470)?

Rickettsia bellii Putative sensor histidine kinase ntrY-like (RBE_0470) is a transmembrane protein belonging to the two-component signal transduction system family in bacteria. The full-length protein consists of 610 amino acids with a His-tag at the N-terminal for purification purposes when expressed recombinantly. The protein functions as a sensor histidine kinase that likely detects specific environmental stimuli and transduces signals through its kinase domain .

The protein's amino acid sequence reveals characteristic features of histidine kinases, including predicted transmembrane regions and cytoplasmic domains involved in signal transduction. As a sensor histidine kinase, RBE_0470 would typically work in conjunction with a response regulator that mediates cellular responses, often through differential gene expression .

How does RBE_0470 fit into the classification system of histidine kinases?

Based on the comprehensive classification system outlined in the literature, RBE_0470 likely belongs to the periplasmic-sensing histidine kinase group. These proteins typically contain an extracellular input domain flanked by transmembrane regions and a cytoplasmic kinase domain .

The classification of histidine kinases is primarily based on their sensing mechanism and domain architecture:

  • Periplasmic-sensing histidine kinases - detect stimuli through an extracellular input domain

  • Transmembrane region-associated histidine kinases - detect stimuli via membrane-spanning segments

  • Cytoplasmic-sensing histidine kinases - detect cellular or diffusible signals reporting metabolic or developmental state

The domain architecture of RBE_0470 suggests it functions as a periplasmic sensor, potentially detecting small solutes or other environmental stimuli through its extracellular domain, though specific experimental confirmation would be necessary.

What are the key conserved domains in RBE_0470 and their functional significance?

RBE_0470 contains several conserved domains typical of sensor histidine kinases. While the specific domain architecture is not explicitly detailed in the search results for this particular protein, histidine kinases typically contain:

  • An input (or sensor) domain - highly variable region reflecting the diversity of signals it detects

  • A transmitter (or kinase) domain - conserved cytoplasmic region involved in phosphotransfer reactions

  • Potential additional domains such as HAMP, PAS, or GAF domains that may be involved in signal transduction

The functional significance of these domains relates to the protein's role in environmental sensing and signal transduction. The conserved histidine residue in the kinase domain undergoes autophosphorylation in response to stimulus detection, initiating the phosphorelay that ultimately affects gene expression through the cognate response regulator .

What are the optimal expression and purification conditions for recombinant RBE_0470?

The recombinant full-length Rickettsia bellii Putative sensor histidine kinase ntrY-like (RBE_0470) protein is optimally expressed in E. coli expression systems with an N-terminal His-tag to facilitate purification. After expression, the protein is typically purified and supplied as a lyophilized powder .

For reconstitution and storage:

  • The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Addition of 5-50% glycerol (final concentration) is recommended for long-term storage.

  • The default final concentration of glycerol used is typically 50%.

  • After reconstitution, the protein should be aliquoted to avoid repeated freeze-thaw cycles.

  • Storage should be at -20°C/-80°C for long-term preservation, while working aliquots can be stored at 4°C for up to one week .

The storage buffer typically consists of Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain protein stability .

How can researchers assess the functional activity of purified RBE_0470?

While the search results don't specifically detail activity assays for RBE_0470, researchers can adapt standard methodologies for testing histidine kinase activity based on the protein's classification as a sensor histidine kinase:

  • Autophosphorylation assay: Incubate the purified protein with ATP (typically radiolabeled γ-³²P-ATP) and analyze phosphorylation of the conserved histidine residue via SDS-PAGE and autoradiography.

  • Phosphotransfer assay: If the cognate response regulator is known or can be predicted, test the ability of phosphorylated RBE_0470 to transfer the phosphoryl group to its partner response regulator.

  • Ligand binding studies: To identify potential stimuli sensed by RBE_0470, researchers could employ techniques such as isothermal titration calorimetry (ITC) or surface plasmon resonance (SPR) with candidate ligands.

  • In vivo reporter systems: Create fusion constructs with reporter genes downstream of promoters regulated by the cognate response regulator to monitor activation of the signaling pathway in response to various stimuli .

The functional characterization would be similar to approaches used for other histidine kinases, such as those described for studying the roles of RickA in Rickettsia species .

What transformation techniques are effective for studying RBE_0470 function in Rickettsia?

Based on the methodologies described for similar Rickettsia studies, effective transformation techniques for studying RBE_0470 function would likely include:

  • Shuttle vector transformation: Similar to the approach used for rickA expression, researchers could use plasmid shuttle vectors carrying spectinomycin resistance and a GFPuv reporter. The shuttle vector could be designed to either overexpress RBE_0470, express a modified version, or include a knockout construct .

  • Copy number and expression analysis: qPCR can be used to determine the copy number of the transformed gene relative to a single-copy reference gene such as gltA. This allows quantification of both native and shuttle vector-carried gene copies .

  • Transcriptional analysis: RT-qPCR can be employed to evaluate the expression levels of native and shuttle vector-carried RBE_0470, again using gltA as a reference for consistent expression .

When designing transformation experiments, it's important to consider the potential phenotypic effects of overexpression or heterologous expression, as observed in the case of R. monacensis rickA expression in R. bellii, which significantly altered motility characteristics and intercellular spread .

How does the stimulus perception mechanism of RBE_0470 compare to other histidine kinases in bacterial pathogens?

As a putative sensor histidine kinase ntrY-like protein, RBE_0470 likely belongs to the nitrogen regulation system, which regulates nitrogen metabolism in response to environmental nitrogen availability. While the specific stimulus perception mechanism of RBE_0470 hasn't been experimentally determined in the search results, its classification provides insights for comparative analysis.

Histidine kinases employ diverse sensing mechanisms depending on their group:

Sensing GroupTypical StimuliSensing MechanismExamples
Periplasmic-sensingSmall solutes, nutrientsVia extracellular input domainNarX/Q, CitA/DcuS
TMR-associatedMembrane conditions, osmolarityVia membrane-spanning segmentsDesK, ComD, LiaS
Cytoplasmic-sensingMetabolic state, diffusible signalsVia cytoplasmic domainsKdpD, ArcB

The NtrY-like proteins typically function as periplasmic sensors involved in nitrogen regulation. While RBE_0470 is annotated as "NtrY-like," detailed experimental characterization would be necessary to confirm its specific sensing mechanism and stimuli .

Unlike membrane-spanning histidine kinases that detect physical changes in the membrane or cytoplasmic sensors that monitor intracellular conditions, periplasmic sensors like RBE_0470 typically respond to external stimuli through direct ligand binding in the periplasmic space .

What insights can genomic and phylogenetic analyses provide about the evolution of RBE_0470 in Rickettsia species?

Genomic and phylogenetic analyses of RBE_0470 can reveal important evolutionary patterns and functional adaptations among Rickettsia species. While the search results don't provide specific phylogenetic data for RBE_0470, we can outline the approach researchers should take:

  • Sequence conservation analysis: Compare RBE_0470 sequences across Rickettsia species to identify conserved and variable regions. Highly conserved regions likely indicate functional importance, while variable regions might reflect adaptation to different environmental niches.

  • Domain architecture comparison: Analyze whether the domain organization of RBE_0470 is consistent across Rickettsia species or shows lineage-specific variations that might indicate functional adaptations.

  • Synteny analysis: Examine the genomic context of RBE_0470 across Rickettsia species to determine if it's part of a conserved operon or if gene rearrangements have occurred.

  • Selection pressure analysis: Calculate dN/dS ratios to identify regions under positive or purifying selection, providing insights into functional constraints.

The high variability observed in sensor domains of histidine kinases compared to the more conserved kinase domains suggests that RBE_0470 may show species-specific adaptations in its sensing domain while maintaining conserved signaling functions .

What are the implications of RBE_0470 for understanding Rickettsia bellii pathogenicity and host-pathogen interactions?

While the search results don't directly address RBE_0470's role in pathogenicity, we can make informed inferences based on the general functions of sensor histidine kinases in bacterial pathogens:

  • Environmental adaptation: As a sensor histidine kinase, RBE_0470 likely helps R. bellii adapt to changing environmental conditions within the host, potentially sensing key host-derived signals that trigger appropriate bacterial responses.

  • Regulation of virulence factors: Many two-component systems in pathogens regulate virulence gene expression. RBE_0470 might control genes involved in host invasion, immune evasion, or nutrient acquisition.

  • Cell-to-cell spread: The research on R. bellii transformants demonstrated that altering signaling proteins (like RickA) can significantly impact cell-to-cell spread capabilities. Similar mechanisms might apply to RBE_0470-regulated processes .

  • Host specificity: The sensing domain of RBE_0470 might be adapted to detect specific host-derived signals, potentially contributing to host tropism of R. bellii.

Research approaches to investigate these aspects could include:

  • Creating knockout or overexpression strains to assess changes in virulence

  • Identifying the stimulus detected by RBE_0470 and its cognate response regulator

  • Determining the regulon controlled by the RBE_0470 two-component system

  • Examining expression patterns of RBE_0470 during different stages of infection

What are common challenges in working with recombinant RBE_0470 and how can they be addressed?

Working with recombinant membrane proteins like RBE_0470 presents several technical challenges:

  • Protein solubility and stability: Transmembrane proteins are often difficult to maintain in solution.

    • Solution: Use appropriate detergents during purification; adhere to the recommended reconstitution protocol with 6% Trehalose in the buffer system at pH 8.0; follow the glycerol addition guidelines (5-50% final concentration) for long-term storage .

  • Proper folding during recombinant expression: Ensuring correct folding of the transmembrane domains in E. coli expression systems.

    • Solution: Optimize expression conditions (temperature, induction time); consider specialized E. coli strains designed for membrane protein expression.

  • Functionality verification: Confirming that the recombinant protein retains its native activity.

    • Solution: Develop appropriate functional assays as outlined in question 2.2; compare with known activity parameters of similar histidine kinases.

  • Freeze-thaw degradation: Repeated freeze-thaw cycles can lead to protein degradation.

    • Solution: Explicitly mentioned in the product information: "Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week" .

  • Purity assessment: Ensuring high purity for experimental reliability.

    • Solution: The product is reported to have "Greater than 90% purity as determined by SDS-PAGE" ; researchers should verify this with their own quality control if necessary.

How can researchers differentiate between the functions of RBE_0470 and other histidine kinases in Rickettsia bellii?

Differentiating the specific functions of RBE_0470 from other histidine kinases in R. bellii requires a multi-faceted approach:

  • Gene knockout or knockdown studies: Create specific knockout mutants of RBE_0470 and assess phenotypic changes compared to wild-type bacteria. This approach could utilize transformation techniques similar to those described for rickA studies .

  • Complementation experiments: After generating a knockout, reintroduce either wild-type or mutated versions of RBE_0470 to verify which functions are specifically attributable to this protein.

  • Stimuli-specific response assessment: Test bacterial responses to various environmental stimuli in wild-type versus RBE_0470-deficient strains to identify the specific stimuli sensed by this kinase.

  • Phosphotransfer profiling: Identify the specific response regulator(s) that receive phosphoryl groups from RBE_0470, which would help delineate the precise signaling pathway.

  • Transcriptome analysis: Compare gene expression profiles between wild-type and RBE_0470-deficient strains under various conditions to identify the regulon specifically controlled by this sensor kinase.

  • Sensor domain swapping: Create chimeric proteins by swapping the sensor domain of RBE_0470 with that of other histidine kinases to determine domain-specific functions.

These approaches would help establish the unique role of RBE_0470 within the broader context of the multiple two-component signaling systems present in R. bellii .

What considerations are important when designing experiments to identify the specific stimuli sensed by RBE_0470?

When designing experiments to identify stimuli sensed by RBE_0470, researchers should consider:

  • Predictive bioinformatic analysis: Analyze the sensor domain sequence and structure to predict potential ligands or stimuli based on similarity to characterized histidine kinases. The NtrY-like annotation suggests involvement in nitrogen sensing, providing a starting point .

  • Systematic stimulus screening: Design experiments that systematically test bacterial responses to:

    • Different nitrogen sources and concentrations

    • Varying oxygen levels

    • pH changes

    • Osmolarity fluctuations

    • Host-derived molecules

    • Redox conditions

  • In vitro binding assays: Purify the isolated sensor domain of RBE_0470 and perform binding assays with candidate ligands using techniques like:

    • Isothermal titration calorimetry

    • Surface plasmon resonance

    • Fluorescence-based binding assays

    • Pull-down assays with potential ligands

  • Reporter system development: Construct reporter systems where RBE_0470 activation leads to measurable output, such as:

    • Transcriptional fusions with reporter genes

    • FRET-based sensors that detect conformational changes

    • Phosphorylation-specific detection systems

  • Structural considerations: The classification of RBE_0470 as a periplasmic-sensing histidine kinase suggests it likely detects extracellular stimuli through its periplasmic domain, so experimental designs should focus on molecules that would be present in this compartment .

  • Cross-species comparisons: Compare responses in different Rickettsia species that contain RBE_0470 homologs to identify conserved sensing mechanisms.

Through these systematic approaches, researchers can narrow down the specific stimuli that activate RBE_0470 and better understand its role in Rickettsia bellii environmental adaptation and pathogenicity.

What emerging technologies might enhance our understanding of RBE_0470 function and regulation?

Several cutting-edge technologies offer promising avenues for deeper investigation of RBE_0470:

  • Cryo-EM and structural biology: Determining the three-dimensional structure of RBE_0470 in different activation states would provide mechanistic insights into signal transduction. Recent advances in cryo-EM have made membrane protein structural studies more accessible.

  • CRISPR-Cas9 genome editing in Rickettsia: Although challenging, adapting CRISPR-Cas9 for Rickettsia would allow more precise genetic manipulation than traditional transformation approaches used in previous studies .

  • Single-cell techniques: Applying single-cell RNA-seq or time-lapse microscopy to monitor RBE_0470-regulated responses in individual bacteria during infection could reveal heterogeneity in signaling responses.

  • Phosphoproteomics: Global phosphoproteomic analysis comparing wild-type and RBE_0470-deficient strains could identify the complete set of proteins affected by this signaling pathway.

  • Biosensors for real-time monitoring: Developing FRET-based biosensors to monitor RBE_0470 activation in real-time during infection could provide temporal information about signaling dynamics.

  • In situ structural techniques: Methods like DEER spectroscopy could probe conformational changes in RBE_0470 within intact bacterial cells under various conditions.

  • Artificial intelligence for protein function prediction: Advanced machine learning algorithms could predict potential ligands and interaction partners based on sequence and structural features of RBE_0470.

These technologies would complement traditional approaches and potentially reveal new aspects of RBE_0470 function that are difficult to assess with conventional methods.

How might RBE_0470 be targeted for therapeutic intervention against Rickettsia infections?

While the search results don't directly address therapeutic targeting of RBE_0470, histidine kinases represent attractive antimicrobial targets due to their absence in mammals and essential roles in bacterial adaptation. Potential therapeutic strategies include:

  • Small molecule inhibitors: Design inhibitors targeting:

    • The ATP-binding pocket of the kinase domain

    • The conserved histidine residue that undergoes phosphorylation

    • The sensor domain to prevent stimulus detection

    • Protein-protein interactions with the cognate response regulator

  • Peptide inhibitors: Develop peptides that mimic interaction surfaces between RBE_0470 and its signaling partners to disrupt signal transduction.

  • Structure-based drug design: Once structural information becomes available, rational design of inhibitors with high specificity for RBE_0470 would be possible.

  • Combinatorial approaches: Target multiple two-component systems simultaneously to overcome potential redundancy in signaling networks.

  • Drug delivery considerations: Since Rickettsia are intracellular pathogens, effective therapeutics would need to penetrate host cell membranes to reach the bacteria.

  • Resistance prevention: Design inhibitor cocktails or dual-targeting compounds to reduce the likelihood of resistance development.

The therapeutic potential would depend on confirming whether RBE_0470 is essential for Rickettsia survival or virulence, which would require knockout studies as described in previous sections .

What are the potential applications of RBE_0470 in synthetic biology and bioengineering?

Sensor histidine kinases like RBE_0470 offer several intriguing applications in synthetic biology and bioengineering:

  • Biosensor development: The sensor domain could be repurposed to create biosensors for detecting specific environmental signals, potentially including:

    • Nitrogen compounds if RBE_0470 indeed functions as an NtrY-like sensor

    • Host-derived molecules if it plays a role in host-pathogen interactions

    • Other environmental parameters relevant to its native function

  • Synthetic signaling circuits: Engineering artificial two-component systems incorporating RBE_0470 components could create programmable bacteria that respond to specific stimuli with defined outputs.

  • Protein engineering platforms: The modular nature of histidine kinases allows for domain swapping and creation of chimeric proteins with novel sensing capabilities. The experience with rickA expression in R. bellii demonstrates the feasibility of expressing heterologous signaling proteins, albeit with potential phenotypic consequences .

  • Controlled gene expression systems: RBE_0470 regulatory elements could be adapted to create inducible gene expression systems responding to specific stimuli.

  • Diagnostic applications: Engineered bacteria expressing modified versions of RBE_0470 could serve as diagnostic tools by producing detectable signals in response to specific biomarkers.

  • Fundamental research tools: RBE_0470 variants could serve as tools to study signal transduction mechanisms and protein-protein interactions in diverse bacterial species.

The applications would be enhanced by thorough characterization of RBE_0470's sensing specificity, kinase activity, and interaction partners, building upon the approaches used in related research on Rickettsia signaling proteins .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.