Recombinant Rickettsia bellii Succinate dehydrogenase cytochrome b556 subunit (sdhC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
sdhC; RBE_1168; Succinate dehydrogenase cytochrome b556 subunit; Cytochrome b-556
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Rickettsia bellii (strain RML369-C)
Target Names
Target Protein Sequence
MTKTKQEIYNKRPTSPHLTIYKPQISSTLSILHRMTGVALFFAVSILAWWFILSKFDSNY IKLANCCCIIKICLILTSFAWFYHLCNGIRHLFWDIGLGFSIKAVNLTGWSVVICSVLFT ILLWV
Uniprot No.

Target Background

Function
Membrane-bound subunit of succinate dehydrogenase (SDH).
Database Links

KEGG: rbe:RBE_1168

Protein Families
Cytochrome b560 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological function of Succinate Dehydrogenase Cytochrome b556 Subunit (sdhC) in Rickettsia bellii?

The sdhC subunit serves as one of the hydrophobic membrane-anchoring components of the succinate dehydrogenase complex (SDH, also known as Complex II) in the bacterial respiratory chain. In R. bellii, it functions as part of the SDH complex that catalyzes the oxidation of succinate to fumarate in the tricarboxylic acid (TCA) cycle while reducing ubiquinone to ubiquinol in the electron transport chain. The sdhC subunit specifically contributes to the formation of the ubiquinone binding site and membrane anchoring of the complex. This function is crucial for R. bellii's energy metabolism, particularly given its intracellular lifestyle where metabolic adaptations are essential for survival within host cells .

How does R. bellii sdhC compare structurally and functionally to other rickettsia species?

R. bellii sdhC exhibits key structural similarities to other rickettsial species, but with notable differences that reflect its evolutionary position. As R. bellii is considered one of the earliest diverging species of Rickettsia, its genome does not exhibit the colinearity observed between other rickettsia genomes . This is also reflected in its metabolic proteins including sdhC.
Comparative analysis shows:

  • R. bellii sdhC contains conserved transmembrane helices typical of cytochrome b556 subunits

  • Functional analyses demonstrate that despite genomic differences, the core enzymatic function remains conserved

  • Phylogenetic studies position R. bellii sdhC as distinct from both spotted fever group (SFG) and typhus group (TG) rickettsiae
    This divergence is supported by genomic evidence showing that R. bellii has retained some ancestral features lost in other lineages, which may be reflected in subtle structural differences in metabolic proteins like sdhC .

What is the optimal expression system for producing recombinant R. bellii sdhC protein?

The optimal expression system for R. bellii sdhC is E. coli, with specific considerations for membrane protein expression. Based on established protocols for related rickettsia proteins:

  • Expression vector selection: pET vector systems with N-terminal His-tags have demonstrated success, as seen with the related sdhD subunit .

  • E. coli strain considerations: BL21(DE3) or C41(DE3) strains are recommended, with the latter specifically engineered for membrane protein expression.

  • Induction parameters:

    • Temperature: Lower temperatures (16-20°C) post-induction

    • IPTG concentration: 0.1-0.5 mM

    • Duration: Extended expression (12-18 hours)

  • Buffer optimization: Inclusion of glycerol (5-10%) and mild detergents (0.5-1% n-dodecyl β-D-maltoside) in lysis and purification buffers improves yield and stability.
    The expression protocol should be optimized to account for the hydrophobic nature of sdhC, which can lead to inclusion body formation if expressed under standard conditions .

What are the most effective methods for assessing the purity and functionality of recombinant R. bellii sdhC?

A multi-faceted approach should be employed:

  • Purity assessment:

    • SDS-PAGE with Coomassie staining (target >90% purity)

    • Western blot analysis using anti-His antibodies

    • Size exclusion chromatography

  • Functional characterization:

    • Succinate:ubiquinone oxidoreductase activity assays

    • Measurement of electron transfer using artificial electron acceptors (DCPIP reduction)

    • Reconstitution experiments with other SDH subunits

  • Structural integrity verification:

    • Circular dichroism spectroscopy to confirm secondary structure

    • Limited proteolysis to assess proper folding

    • Thermal shift assays to determine stability
      For maximum reliability, functional assays should be performed in comparison with known standards and include negative controls with inactive enzyme (heat-denatured or with specific inhibitors) .

How can recombinant R. bellii sdhC be used to investigate the evolution of energy metabolism in intracellular bacteria?

Recombinant R. bellii sdhC offers a valuable tool for investigating evolutionary adaptations in energy metabolism among obligate intracellular bacteria:

  • Comparative biochemical characterization: The kinetic parameters and substrate preferences of reconstituted SDH complexes containing R. bellii sdhC can be compared with those from other rickettsial species to identify adaptations related to different ecological niches.

  • Mutational analysis: Site-directed mutagenesis of conserved versus divergent residues can reveal how specific amino acid changes have influenced enzyme function during evolution.

  • Protein-protein interaction studies: Pull-down assays using recombinant sdhC as bait can identify differences in interacting partners between R. bellii and other rickettsial species.

  • Ancestral sequence reconstruction: The early diverging position of R. bellii in rickettsial phylogeny makes its sdhC valuable for reconstructing ancestral metabolic capabilities .
    This approach has already revealed that R. bellii maintains some metabolic capabilities lost in other rickettsial lineages that have undergone more extensive genome reduction, providing insights into the evolutionary trade-offs during adaptation to intracellular lifestyles .

What are the methodological challenges in investigating the role of sdhC in R. bellii's interaction with tick hosts?

Investigating sdhC function in tick-rickettsia interactions presents several methodological challenges:

  • Genetic manipulation limitations:

    • Limited transformation efficiency in Rickettsia

    • Challenges in creating targeted knockouts of essential metabolic genes

    • Need for inducible expression systems that don't yet exist for Rickettsia

  • Tick cell model systems:

    • Requirement for specialized tick cell lines

    • Complexity of mimicking natural infection conditions

    • Need for co-infection models to study competition with other tick-borne bacteria

  • Recommended methodological approaches:

    • Heterologous expression of R. bellii sdhC in surrogate bacterial systems

    • Development of tick cell infection models with fluorescently labeled R. bellii

    • Application of TaqMan assays specific for R. bellii metabolic gene expression in infected ticks

  • Data analysis considerations:

    • Need for appropriate statistical methods to account for biological variability

    • Careful experimental design to control for confounding factors in tick-based assays3
      These challenges necessitate innovative experimental designs that combine molecular techniques with appropriate tick models and rigorous statistical analysis .

How should researchers approach contradictory data when characterizing R. bellii sdhC interactions with host mitochondrial proteins?

When encountering contradictory data regarding R. bellii sdhC interactions with host mitochondrial proteins, researchers should:

  • Systematically evaluate experimental parameters:

    • Cell/tissue type differences (tick vs. mammalian cells)

    • Protein expression levels and tags

    • Buffer and reaction conditions

    • Detection methods and their sensitivity

  • Apply multiple complementary techniques:

    • Cross-validate interactions using pull-down, co-immunoprecipitation, and proximity labeling

    • Perform in vitro and in vivo interaction studies

    • Use both recombinant proteins and native complexes

  • Consider biological context:

    • R. bellii's unique evolutionary position may result in different host interactions compared to other rickettsial species

    • The bacterium's ability to survive in both arthropod vectors and mammalian hosts may lead to context-dependent protein interactions

  • Statistical analysis approach:

    • Apply appropriate statistical tests for reproducibility

    • Consider multiple hypothesis testing corrections

    • Report effect sizes alongside significance values3
      A methodical approach that acknowledges the biological complexity of host-pathogen interactions is essential for resolving contradictory findings .

What statistical approaches are most appropriate for analyzing structure-function relationships in R. bellii sdhC mutational studies?

For analyzing structure-function relationships in R. bellii sdhC mutational studies, the following statistical approaches are recommended:

How can researchers troubleshoot poor expression yields of recombinant R. bellii sdhC protein?

Poor expression yields of recombinant R. bellii sdhC can be addressed through a systematic troubleshooting approach:

  • Codon optimization strategies:

    • Analyze the codon usage bias between R. bellii and the expression host

    • Consider synthetic gene synthesis with optimized codons

    • Use expression strains with rare codon tRNAs (e.g., Rosetta strains)

  • Expression construct modifications:

    • Test alternative fusion tags (SUMO, MBP, GST) that can enhance solubility

    • Explore different tag positions (N-terminal vs. C-terminal)

    • Consider truncation constructs that remove highly hydrophobic regions

  • Expression condition optimization:

    • Screen multiple temperatures (37°C, 30°C, 25°C, 18°C)

    • Test various induction methods (IPTG concentration gradient, auto-induction media)

    • Explore different media compositions (LB, TB, minimal media with supplements)

  • Cell lysis and extraction optimization:

    • Test different detergents for membrane protein extraction (DDM, LDAO, Triton X-100)

    • Optimize detergent concentration and buffer composition

    • Consider extraction time and temperature

  • Storage considerations:

    • As observed with related proteins, avoid repeated freeze-thaw cycles

    • Store working aliquots at 4°C for up to one week

    • For long-term storage, add 5-50% glycerol and store at -20°C/-80°C
      This methodical approach should help identify and address the specific factors limiting expression yield.

What are the critical factors to consider when designing experiments to compare R. bellii sdhC function with orthologous proteins from pathogenic rickettsial species?

When designing comparative experiments between R. bellii sdhC and orthologs from pathogenic species, consider these critical factors:

  • Sequence and structural homology assessment:

    • Perform multiple sequence alignments to identify conserved and variable regions

    • Use structural prediction tools to map these differences onto predicted protein structures

    • Create a table of key functional residues across species for targeted analysis

  • Experimental standardization:

    • Express all proteins using identical systems and purification methods

    • Characterize proteins under identical conditions (pH, temperature, ionic strength)

    • Perform assays in parallel with the same reagent lots

  • Functional assay selection:

    • Choose assays that interrogate different aspects of sdhC function:

      • Membrane integration

      • Complex formation with other SDH subunits

      • Electron transfer capability

      • Substrate binding properties

  • Biological context considerations:

    • R. bellii's unique evolutionary position between ancestral and more recently evolved rickettsiae

    • Its ability to survive in both arthropod vectors and mammalian hosts

    • The different pathogenic potentials (R. bellii has unknown pathogenicity while others like R. rickettsii are highly pathogenic)

  • Controls and validation:

    • Include positive controls (well-characterized SDH proteins)

    • Use negative controls (inactive mutants or non-related membrane proteins)

    • Validate key findings with complementary techniques
      This approach enables meaningful comparison while accounting for the evolutionary and pathogenic differences between R. bellii and other rickettsial species .

How can recombinant R. bellii sdhC be used to investigate the differences in intracellular survival between pathogenic and non-pathogenic rickettsiae?

Recombinant R. bellii sdhC can serve as a valuable tool for investigating differences in intracellular survival strategies:

  • Comparative metabolic studies:

    • Reconstitute SDH complexes with recombinant subunits from R. bellii and pathogenic species

    • Compare enzymatic activities under conditions mimicking different intracellular environments

    • Analyze how these differences correlate with survival in macrophages or endothelial cells

  • Host protein interaction analyses:

    • Use pull-down assays with recombinant sdhC to identify host interaction partners

    • Compare interaction profiles between R. bellii and pathogenic species

    • Validate key interactions through co-immunoprecipitation in infected cells

  • Experimental setup for studying intracellular behavior:

    • Create fluorescently tagged sdhC constructs for localization studies

    • Observe co-localization with mitochondria or other host organelles

    • Compare patterns between R. bellii and pathogenic rickettsiae

  • Relevance to pathogenesis:

    • R. bellii shows different behavior in human macrophages compared to pathogenic species

    • While pathogenic rickettsiae like R. rickettsii and R. parkeri maintain intact morphology and avoid lysosomal compartments, R. bellii particles appear fragmented and co-localize with Cathepsin D and LAMP-2, similar to other non-pathogenic rickettsiae
      This approach can reveal how metabolic adaptations, including differences in SDH complex components, contribute to the distinct intracellular survival strategies of different rickettsial species .

What experimental design would best elucidate the potential role of R. bellii sdhC in adaptation to different host environments?

To elucidate R. bellii sdhC's role in host adaptation, an integrated experimental approach is recommended:

  • Comparative expression analysis:

    • Design qPCR assays specific for R. bellii sdhC gene expression

    • Measure expression levels during infection of different host cells:

      • Arthropod cells (tick cell lines)

      • Mammalian endothelial cells

      • Macrophages

    • Monitor expression changes across time points post-infection

  • Protein function under host-specific conditions:

    • Reconstitute SDH complexes containing R. bellii sdhC

    • Assess enzymatic activity under conditions mimicking different host environments:

      • Variable pH (5.5-7.5)

      • Different oxygen tensions

      • Varying nutrient availability

  • Genetic complementation studies:

    • Express R. bellii sdhC in surrogate bacterial systems

    • Test complementation of sdhC-deficient strains

    • Compare with complementation by sdhC from pathogenic rickettsiae

  • Host response analysis:

    • Expose host cells to purified recombinant R. bellii sdhC

    • Measure transcriptional and metabolic responses

    • Compare to responses elicited by sdhC from pathogenic species

  • Data analysis framework:

    • Use appropriate statistical methods for time-course experiments

    • Apply multivariate analysis for complex datasets

    • Consider both magnitude and timing of responses3
      This experimental design addresses R. bellii's unique ability to survive in both arthropod vectors and potentially mammalian hosts, while overcoming the technical challenges of directly manipulating obligate intracellular bacteria .

What emerging technologies would enhance the study of R. bellii sdhC structure-function relationships?

Several emerging technologies hold promise for advancing structure-function studies of R. bellii sdhC:

  • Cryo-electron microscopy (Cryo-EM):

    • Enables high-resolution structural analysis without crystallization

    • Particularly valuable for membrane proteins like sdhC

    • Can capture different conformational states of the SDH complex

  • Single-molecule techniques:

    • Fluorescence resonance energy transfer (FRET) to study dynamic conformational changes

    • Single-molecule force spectroscopy to analyze membrane insertion dynamics

    • Allows observation of heterogeneity masked in ensemble measurements

  • Advanced genetic manipulation systems for Rickettsia:

    • CRISPR-based transcriptional activation/inhibition systems

    • Inducible expression systems

    • Site-directed transposition methods

  • Artificial intelligence and computational approaches:

    • AlphaFold2 and similar AI systems for improved structural prediction

    • Molecular dynamics simulations to study membrane integration

    • Machine learning analysis of structure-function relationships

  • Microfluidic and organ-on-chip technologies:

    • Recreate host-vector interfaces for studying environmental adaptations

    • Enable real-time monitoring of metabolic activities

    • Allow precise control of the microenvironment
      These technologies would help overcome current limitations in studying obligate intracellular bacteria like R. bellii and provide deeper insights into the structure-function relationships of sdhC .

How might R. bellii sdhC research contribute to understanding the evolution of bacterial respiratory chains?

Research on R. bellii sdhC offers unique insights into respiratory chain evolution:

  • Evolutionary position advantages:

    • R. bellii represents an early-diverging lineage within Rickettsia

    • Its genome retains ancestral features lost in other rickettsial lineages

    • Contains a complete set of putative conjugal DNA transfer genes

  • Comparative genomics approach:

    • Analysis of sdhC sequence conservation across alpha-proteobacteria

    • Identification of lineage-specific adaptations in the context of genome reduction

    • Mapping of selective pressures on different regions of the protein

  • Methodological framework:

    • Ancestral sequence reconstruction of sdhC

    • Heterologous expression of inferred ancestral proteins

    • Functional characterization of extant and reconstructed proteins

  • Significance for understanding respiratory chain evolution:

    • Insights into adaptation of respiratory complexes during transition to intracellular lifestyle

    • Understanding the minimum functional requirements for electron transport in obligate intracellular bacteria

    • Elucidation of co-evolutionary patterns between respiratory chain components
      R. bellii's genome shows evidence of numerous gene exchanges with amoeba-associated bacteria, suggesting that its respiratory components, including sdhC, may reflect both ancient bacterial features and adaptations acquired through horizontal gene transfer during evolution .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.