Recombinant Rickettsia bellii Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rickettsia bellii Succinate Dehydrogenase Hydrophobic Membrane Anchor Subunit (sdhD)

The Recombinant Rickettsia bellii Succinate Dehydrogenase Hydrophobic Membrane Anchor Subunit (sdhD) is a protein derived from the bacterium Rickettsia bellii. This subunit is part of the succinate dehydrogenase complex, which plays a crucial role in the electron transport chain and is essential for cellular respiration. The sdhD subunit serves as a hydrophobic membrane anchor, facilitating the integration of the succinate dehydrogenase complex into the bacterial cell membrane.

Characteristics of Recombinant Rickettsia bellii sdhD

  • Expression System: This recombinant protein is typically expressed in Escherichia coli (E. coli), a common host for recombinant protein production due to its well-understood genetics and ease of manipulation .

  • Tagging: The protein is often tagged with a His-tag at the N-terminal, which aids in purification using affinity chromatography .

  • Sequence and Length: The full-length protein consists of 125 amino acids, and its sequence is crucial for its function as a membrane anchor .

  • Purity: The purity of the recombinant protein is generally greater than 90%, ensuring high-quality material for research applications .

Data Tables

CharacteristicsDescription
Expression SystemEscherichia coli
TagN-terminal His-tag
Sequence Length125 amino acids
PurityGreater than 90%
FunctionHydrophobic membrane anchor

References Creative Biomart. Recombinant Full Length Rickettsia Bellii Succinate Dehydrogenase Hydrophobic Membrane Anchor Subunit(Sdhd) Protein, His-Tagged. Cusabio. Recombinant Rickettsia bellii Succinate dehydrogenase hydrophobic membrane anchor subunit (sdhD). PubMed. Characterization of the succinate dehydrogenase-encoding gene cluster of Coxiella burnetii.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted per customer request.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
sdhD; RBE_1167; Succinate dehydrogenase hydrophobic membrane anchor subunit
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-125
Protein Length
full length protein
Species
Rickettsia bellii (strain RML369-C)
Target Names
Target Protein Sequence
MTYDFRAEIVKAKNTGSAKSGSHHWLLQRITAIILVLCSLWLLYFTLANKNSDVNIIIWE LKRPINLIPLLIAVITSLYHAMLGMQVVIEDYISCNKLRNTLIIAVKLFSILTIVAFIVA VFYRG
Uniprot No.

Target Background

Function
Membrane-anchoring subunit of succinate dehydrogenase (SDH).
Database Links

KEGG: rbe:RBE_1167

Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biological role of SdhD in R. bellii metabolism?

SdhD functions as one of four subunits in the succinate dehydrogenase complex (SDH, Complex II), which plays a crucial role in both the tricarboxylic acid cycle and electron transport chain. In R. bellii, an obligate intracellular bacterium, this protein is particularly significant as it anchors the catalytic subunits (SdhA and SdhB) to the bacterial membrane, enabling electron transfer from succinate oxidation to the respiratory chain . The SdhD subunit also contains a heme b group that facilitates electron transfer to ubiquinone. Given R. bellii's limited metabolic pathways compared to free-living bacteria, this enzyme complex represents a critical junction between energy-generating pathways, making SdhD essential for the bacterium's survival within host cells.

What genomic context surrounds the sdhD gene in R. bellii?

The sdhD gene in R. bellii is typically part of the sdh operon, which includes genes encoding all four SDH subunits. Compared to free-living bacteria, the R. bellii sdh operon generally exhibits more compact organization with fewer regulatory elements, consistent with the genome reduction observed in obligate intracellular bacteria . Analysis of the genomic neighborhood can provide valuable insights into potential co-regulated genes and evolutionary relationships. The streamlined regulatory architecture likely reflects adaptation to the relatively stable intracellular environment, where complex regulatory networks may be less necessary than in bacteria facing diverse external conditions.

What expression systems are most effective for recombinant R. bellii SdhD production?

Due to the hydrophobic nature and membrane integration requirements of SdhD, several specialized expression systems have proven effective:

  • E. coli strains specifically designed for membrane protein expression (C41/C43) combined with low-temperature induction (16-18°C) to improve proper folding

  • Cell-free expression systems supplemented with detergents or lipid nanodiscs to facilitate proper folding of hydrophobic domains

  • Baculovirus-insect cell systems for functional studies requiring proper membrane integration, especially when co-expressing with other SDH subunits
    The pRAM18dSGA vector system, which has been successfully used for expressing recombinant proteins in R. bellii, represents another potential approach, though it presents challenges for high-yield production . Selection of the optimal expression system should be guided by specific experimental objectives and the intended downstream applications.

What purification strategies yield functional recombinant SdhD?

Purification of functional R. bellii SdhD requires a multi-step approach tailored to membrane proteins:

Purification StageMethodCritical Parameters
Membrane ExtractionDifferential centrifugation followed by detergent solubilizationDetergent selection (DDM, LMNG often effective); detergent concentration above CMC
Initial CaptureAffinity chromatography (IMAC for His-tagged constructs)Inclusion of detergent and stabilizing agents (glycerol 10-20%)
Intermediate PurificationSize exclusion chromatographyDetection of properly folded monomers versus aggregates
Final PolishingIon exchange chromatographyBuffer optimization to maintain native conformation
Quality AssessmentSDS-PAGE, western blot, mass spectrometryConfirmation of purity and intact protein
Maintaining a stable membrane-mimetic environment throughout purification is essential for obtaining properly folded, functional SdhD. The choice and sequence of purification steps should be optimized based on preliminary experiments to determine which combination provides the highest yield of active protein.

How can the hydrophobic nature of SdhD be managed during recombinant expression?

Managing the hydrophobic nature of R. bellii SdhD requires strategic approaches at multiple levels:

  • Fusion partners: Solubility-enhancing tags (MBP, SUMO, thioredoxin) shield hydrophobic regions during translation and folding

  • Co-expression strategies: Expression with natural binding partners (SdhC) improves stability through native protein-protein interactions

  • Membrane-mimetic environments: Addition of appropriate detergents during cell lysis and purification maintains protein solubility

  • Expression conditions: Reduced temperatures (16-20°C), lower inducer concentrations, and extended expression times promote proper folding

  • Specialized expression strains: E. coli strains with enhanced membrane protein expression capacity reduce toxicity and improve yields
    These approaches have been shown to significantly improve the yield and quality of recombinant membrane proteins from intracellular bacteria similar to R. bellii .

What assays can measure the electron transport function of recombinant R. bellii SdhD?

Measuring electron transport function requires specialized assays that detect SdhD's role in the succinate-to-ubiquinone electron transfer pathway:

  • Succinate-dependent reduction of artificial electron acceptors (DCIP, ferricyanide) monitored spectrophotometrically at specific wavelengths

  • Direct measurement of ubiquinone reduction using ubiquinone analogs like decylubiquinone, tracking absorbance decrease at 275 nm

  • Oxygen consumption measurements using a Clark-type electrode in reconstituted systems containing complete electron transport components

  • Membrane potential assays using fluorescent dyes in proteoliposomes containing reconstituted SDH

  • EPR spectroscopy to monitor redox state changes in iron-sulfur clusters and heme groups during enzyme turnover
    These functional assays are most informative when comparing wild-type SdhD with site-directed mutants or analyzing inhibitor effects, providing insights into the electron transfer mechanism through the SDH complex.

How can protein-protein interactions between SdhD and other SDH subunits be studied?

Investigating interactions between R. bellii SdhD and other SDH subunits requires techniques optimized for membrane proteins:

  • Co-immunoprecipitation using antibodies against tagged versions of SdhD or other subunits

  • Bacterial two-hybrid systems modified for membrane proteins (BACTH)

  • FRET analysis using fluorophore-tagged subunits to detect proximity in membrane environments

  • Surface plasmon resonance for kinetic and affinity measurements with purified components

  • Cross-linking coupled with mass spectrometry to identify specific interaction regions

  • Native gel electrophoresis to detect intact complexes formation
    Selection of appropriate methods depends on whether the goal is simply to detect interactions or to characterize them quantitatively. Transformation systems demonstrated for R. bellii can potentially be adapted to express tagged versions of SdhD for in vivo interaction studies .

How can site-directed mutagenesis be used to study R. bellii SdhD function?

Site-directed mutagenesis provides a powerful approach to dissect structure-function relationships in R. bellii SdhD:

  • Target selection: Key residues for mutagenesis include:

    • Heme-coordinating residues (typically histidines)

    • Interface residues with other SDH subunits

    • Residues potentially involved in quinone binding

    • Transmembrane domain residues affecting membrane integration

  • Mutation strategies:

    • Alanine scanning to neutralize specific side chain functions

    • Conservative substitutions maintaining general chemical properties

    • Charge-reversal mutations disrupting electrostatic interactions

    • Cysteine introduction for subsequent labeling experiments

  • Functional characterization comparing wild-type and mutant proteins:

    • Thermal stability assays assessing structural integrity

    • Complex assembly assays evaluating interactions with other subunits

    • Enzymatic activity measurements quantifying effects on electron transport

    • Spectroscopic analyses detecting changes in heme environment
      Studies with R. bellii transformed to express modified proteins have demonstrated that such approaches can reveal important functional insights, as exemplified by work with other R. bellii proteins like RickA .

What role might SdhD play in the obligate intracellular lifestyle of R. bellii?

Beyond its canonical role in energy metabolism, SdhD may contribute to R. bellii's intracellular adaptation in several ways:

  • Metabolic adaptation: Optimized energy production in the nutrient-controlled intracellular environment

  • Membrane-host interaction: Specialized membrane integration potentially facilitating survival in host cells

  • Redox homeostasis: Maintaining proper electron flow to prevent oxidative damage in the host environment

  • Potential moonlighting functions: Secondary roles beyond energy metabolism, possibly in host interaction
    R. bellii has been identified in various arthropod vectors, including Amblyomma cajennense ticks, suggesting its SdhD must function across diverse host environments . Research comparing SdhD function between R. bellii and free-living bacteria may reveal adaptations related to its unique ecological niche spanning both vertebrate and invertebrate hosts.

How does the transformation of R. bellii affect SdhD expression and function?

Recent advances in R. bellii transformation techniques provide opportunities to study SdhD in its native context, though with important considerations:

  • Vector effects: Plasmid vectors like pRAM18dSGA can alter expression balance of native genes including the sdh operon

  • Expression level changes: Quantitative analysis comparing SdhD levels between wild-type and transformed strains reveals regulatory impacts

  • Metabolic burden: Resources redirected to maintain plasmids may affect metabolic enzyme expression

  • Transformation strategies for SdhD study:

    • Tagged versions for localization and interaction studies

    • Reporter fusions to monitor expression under different conditions

    • Inducible systems to control expression levels
      Studies with transformed R. bellii have demonstrated that plasmid introduction can substantially alter bacterial phenotypes, including motility, adherence, and host cell infiltration, highlighting the importance of appropriate controls when studying modified strains .

What challenges exist in creating SdhD knockout mutants in R. bellii?

Creating SdhD knockout mutants presents significant challenges:

  • Technical limitations:

    • Low transformation efficiency compared to model organisms

    • Limited selectable markers for rickettsial manipulation

    • Difficulties in isolating clonal populations due to intracellular growth requirements

  • Biological considerations:

    • Potential essentiality of SdhD for energy metabolism

    • Lethal effects of complete knockouts necessitating conditional approaches

    • Pleiotropic effects complicating phenotype interpretation

  • Alternative approaches:

    • Conditional expression systems using tetracycline-responsive promoters

    • CRISPR interference for transcriptional repression rather than deletion

    • Temperature-sensitive mutants retaining function under permissive conditions

    • Chemical inhibition of SDH activity using specific inhibitors
      Studies have successfully transformed R. bellii with various constructs, demonstrating the feasibility of genetic manipulation despite these challenges . The identification of R. bellii in natural environments like the Brazilian Amazon underscores the importance of understanding its core metabolic components like SdhD in their native context .

How can aggregation issues during recombinant SdhD production be addressed?

Addressing aggregation requires a multi-faceted approach targeting various expression and purification stages:

Challenge StageSolution StrategiesMonitoring Methods
ExpressionLower temperatures (16-20°C); Reduced inducer concentration; Fusion partners; Co-expression with chaperonesSDS-PAGE analysis of soluble vs. insoluble fractions
SolubilizationDetergent screening (maltoside, glycoside, zwitterionic); Optimize detergent:protein ratioClear vs. turbid solutions; Western blot of solubilized fractions
Buffer OptimizationpH screening; Stabilizing additives (glycerol, specific lipids); Addition of reducing agentsDynamic light scattering for particle size distribution
Alternative ApproachesCell-free expression with immediate detergent addition; Expression into nanodiscsSize exclusion chromatography profiles
Systematic testing of these approaches using small-scale expression trials, followed by rigorous analysis of protein quality, is the most effective strategy to overcome aggregation issues that commonly affect hydrophobic membrane proteins like SdhD.

What strategies can overcome the toxicity of overexpressed hydrophobic SdhD?

Overcoming toxicity associated with membrane protein overexpression requires strategies that minimize disruption of host cell membranes:

  • Expression regulation:

    • Tight control using promoters with minimal leakage

    • Titratable expression systems allowing fine-tuning

    • Auto-induction media delaying expression until late log phase

  • Host strain optimization:

    • Strains evolved for toxic membrane protein expression

    • Strains with enhanced stress response capability

    • Controlled growth conditions (temperature, media composition)

  • Co-expression approaches:

    • Expression with natural binding partners

    • Chaperone co-expression systems

    • Fusion strategies sequestering hydrophobic regions
      Similar challenges have been observed when expressing other Rickettsia proteins, requiring specific optimization for successful recombinant protein production .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.