Recombinant Rickettsia bellii Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Rickettsia bellii Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA)

Rickettsia bellii Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA), is a component of the enzyme Ubiquinol-Cytochrome C Reductase, also known as UQCRC or Complex III . Complex III is an energy transducing and energy transference enzyme found in the inner mitochondrial membrane of eukaryotic cells and the internal membranes of eubacteria . This enzyme plays a crucial role in cell respiration and the biochemical production of ATP through oxidative phosphorylation . The petA gene encodes for the iron-sulfur subunit of this reductase .

Reaction Mechanism of Ubiquinol-Cytochrome C Reductase

The reaction mechanism for Complex III is known as the ubiquinone (Q) cycle . In this cycle, four protons are released into the intermembrane space, while only two protons are taken up from the matrix, creating a proton gradient across the membrane .

  • 2 x QH2 oxidized to Q

  • 1 x Q reduced to QH2

  • 2 x Cyt c reduced

  • 4 x H+ released into the intermembrane space

  • 2 x H+ picked up from the matrix

The reaction proceeds in two rounds:

Round 1:

  1. Cytochrome b binds a ubiquinol and a ubiquinone .

  2. The 2Fe/2S center and bL heme each remove an electron from the bound ubiquinol, releasing two protons into the intermembrane space .

  3. One electron is transferred to cytochrome c1 from the 2Fe/2S center, while another is transferred from the bL heme to the bH heme .

  4. Cytochrome c1 transfers its electron to cytochrome c, and the bH heme transfers its electron to a nearby ubiquinone, forming a ubisemiquinone .

  5. Cytochrome c diffuses. The first ubiquinol (now oxidized to ubiquinone) is released, while the semiquinone remains bound .

Round 2:

  1. A second ubiquinol is bound by cytochrome b .

  2. The 2Fe/2S center and bL heme each remove an electron from the bound ubiquinol, releasing two protons into the intermembrane space .

  3. One electron is transferred to cytochrome c1 from the 2Fe/2S center, while another is transferred from the bL heme to the bH heme .

  4. Cytochrome c1 then transfers its electron to cytochrome c, while the nearby semiquinone produced from round 1 picks up a second electron from the bH heme, along with two protons from the matrix .

  5. The second ubiquinol (now oxidized to ubiquinone), along with the newly formed ubiquinol, are released .

Recombinant Rickettsia bellii Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA)

Recombinant Rickettsia bellii Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA) is produced using E. coli expression systems . The recombinant protein is typically fused to an N-terminal His tag to facilitate purification .

Table 1: Properties of Recombinant Rickettsia bellii Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA)

PropertyDescription
SourceIn vitro E. coli expression system
Purity≥ 85% as determined by SDS-PAGE
TagN-terminal His tag
OrganismRickettsia bellii (strain RML369-C)
UniProt IDQ1RIA5
Amino Acid SequenceMSDTEDTNNDNKVEFEDRSKTSRRDFMVLTASSVAAVGAACTLWPLINSLNPSADVLALSSIEVDLSNIAVGQTVTVKWQGKPVFITNRTPDKIAEARAVKMSELIDPEEDQDRVKAGHDNWLVTIGICTHLGCVPLANQGDYDGWFCPCHGSQYDSSGRVRRGPAPLNLAVPPYTFISD KKIRIG
Expression Region1-186

Interactions of Ubiquinol-Cytochrome C Reductase

Ubiquinol-Cytochrome C Reductase has 98 protein-protein interactions, of which 90 are co-complex interactions . Some of the proteins that interact with UQCRC include MAPK3, QCR1, CAC1A, STOM, CACNA1A, and HLA-B .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize development accordingly.
Synonyms
petA; RBE_0828; Ubiquinol-cytochrome c reductase iron-sulfur subunit; Rieske iron-sulfur protein; RISP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-186
Protein Length
full length protein
Species
Rickettsia bellii (strain RML369-C)
Target Names
petA
Target Protein Sequence
MSDTEDTNNDNKVEFEDRSKTSRRDFMVLTASSVAAVGAACTLWPLINSLNPSADVLALS SIEVDLSNIAVGQTVTVKWQGKPVFITNRTPDKIAEARAVKMSELIDPEEDQDRVKAGHD NWLVTIGICTHLGCVPLANQGDYDGWFCPCHGSQYDSSGRVRRGPAPLNLAVPPYTFISD KKIRIG
Uniprot No.

Target Background

Function

Recombinant Rickettsia bellii Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA) is a component of the ubiquinol-cytochrome c reductase complex (Complex III or cytochrome b-c1 complex). This complex is a crucial part of the respiratory chain, responsible for generating the electrochemical potential necessary for ATP synthesis.

Database Links

KEGG: rbe:RBE_0828

Subcellular Location
Cell membrane; Single-pass membrane protein.

Q&A

What is Rickettsia bellii and what distinguishes it from other Rickettsia species?

Rickettsia bellii represents the earliest diverging species of known rickettsiae, with several unique characteristics setting it apart from other members of the genus. Unlike most rickettsial species that show genome colinearity, R. bellii's 1,552,076 base pair chromosome does not exhibit this structural conservation . R. bellii is also uniquely versatile in its arthropod host range, being the only rickettsia found in both soft and hard ticks, which gives it the broadest arthropod host distribution among known rickettsiae .

Phylogenetically, R. bellii occupies an early-branching position in the Rickettsia evolutionary tree, suggesting it may have retained ancestral features lost in other lineages. One significant molecular characteristic is its possession of a complete set of putative conjugal DNA transfer genes, most similar to homologues found in Protochlamydia amoebophila UWE25 .

What is the function of Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA) in Rickettsia bellii?

The Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA) is a critical component of the electron transport chain in Rickettsia bellii. This protein functions within the cytochrome bc1 complex (Complex III), facilitating electron transfer from ubiquinol to cytochrome c during oxidative phosphorylation .

The iron-sulfur subunit specifically contains iron-sulfur clusters that accept electrons from ubiquinol and transfer them to subsequent components in the respiratory chain. This process is essential for energy production in R. bellii, generating the proton gradient necessary for ATP synthesis. The functionality of this protein is especially important considering R. bellii's intracellular lifestyle, which requires efficient energy metabolism for survival and replication within host cells .

How is the recombinant petA protein typically expressed and purified?

Recombinant R. bellii Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA) can be produced through multiple expression systems. The primary methods include:

  • Cell-Free Expression System: This system allows for rapid protein production without the constraints of cell viability, particularly useful for potentially toxic proteins .

  • Host-Based Expression: Various hosts can be employed, including:

    • E. coli systems

    • Yeast expression platforms

    • Baculovirus systems with insect cells

    • Mammalian cell expression systems

Standard purification protocols typically achieve ≥85% purity as determined by SDS-PAGE analysis . The purification process generally involves:

  • Initial cell lysis (mechanical or chemical)

  • Clarification of lysate by centrifugation

  • Affinity chromatography using tag-based systems

  • Ion exchange chromatography for further purification

  • Size exclusion chromatography for final polishing

  • Quality control via SDS-PAGE and western blotting

What are the recommended protocols for functional assays of recombinant petA?

For functional characterization of recombinant R. bellii petA, researchers should consider the following assay protocols:

Electron Transfer Activity Assay:

  • Reconstitute purified petA protein with artificial lipid bilayers or in liposome systems

  • Add ubiquinol substrate (typically decylubiquinol for in vitro studies)

  • Measure cytochrome c reduction spectrophotometrically at 550 nm

  • Calculate enzyme activity based on the rate of cytochrome c reduction

Redox Potential Measurement:

  • Employ cyclic voltammetry techniques to determine the redox potential of the iron-sulfur clusters

  • Use differential pulse voltammetry for higher sensitivity measurements

  • Compare results with known standards for validation

Protein-Protein Interaction Studies:

  • Implement pull-down assays using tagged recombinant petA

  • Analyze interactions with other components of the cytochrome bc1 complex

  • Validate findings using surface plasmon resonance or isothermal titration calorimetry

When comparing results across different expression systems, remember that post-translational modifications may vary, potentially affecting functional parameters.

How can researchers effectively design experiments to study R. bellii petA in the context of host-pathogen interactions?

When designing experiments to investigate R. bellii petA in host-pathogen interactions, researchers should adopt a multi-faceted approach:

Cell Culture Models:

  • Establish eukaryotic cell infection models using cell lines permissive to R. bellii infection

  • Create petA knockout or modified strains using genetic manipulation techniques

  • Assess differences in cellular localization, particularly noting R. bellii's ability to multiply in the nucleus of eukaryotic cells

  • Evaluate bacterial replication rates and host cell responses

Amoeba Infection Model:
R. bellii can survive in phagocytic amoeba such as Acanthamoeba polyphaga , offering a valuable experimental system:

  • Culture A. polyphaga under standard conditions

  • Introduce wild-type and petA-modified R. bellii

  • Monitor bacterial survival and proliferation within amoebae

  • Assess potential horizontal gene transfer events, especially relevant given R. bellii's complete set of conjugal DNA transfer genes

Guinea Pig Model:
The guinea pig model has been established for R. bellii pathogenicity studies:

  • Employ intraperitoneal (IP) inoculation of cell culture suspensions

  • Monitor animals for clinical signs including fever, orchitis, and dermatitis

  • Collect ear biopsies and blood samples at 2-3 day intervals

  • Test samples for rickettsial DNA using PCR

  • Perform necropsy and test internal organs using PCR assays

Clinical SignOccurrenceNotes
Fever1/6 animalsSingle-day fever of 40.3°C on 4 DPI
Orchitis1/6 animalsMild scrotal edema
Dermatitis2/6 animalsEar dermatitis observed
Weight gainAll animals3.0–16.3% weight gain during study
Behavioral changesNoneNo abnormal behavior observed

What molecular techniques are most effective for detecting and quantifying R. bellii petA expression?

For optimal detection and quantification of R. bellii petA expression, researchers should employ these molecular techniques:

PCR-Based Methods:

  • Conventional PCR: Design primers targeting the petA gene for qualitative detection

  • Real-time qPCR: Develop SYBR Green or TaqMan-based assays for quantitative analysis

  • Droplet Digital PCR (ddPCR): Use for absolute quantification without standard curves

  • Nested PCR: Implement for increased sensitivity in complex samples

Sequencing Approaches:

  • Sanger Sequencing: Apply for confirmation of PCR amplicons and variant identification

  • Next-Generation Sequencing: Use for transcriptome analysis and expression profiling

  • Nanopore Sequencing: Consider for long-read applications and real-time analysis

Expression Analysis:

  • RT-qPCR: Quantify mRNA levels with proper reference gene normalization

  • RNA-Seq: Perform for genome-wide expression analysis and comparative studies

  • Northern Blotting: Use for specific transcript size determination and validation

Protein Detection:

  • Western Blotting: Employ antibodies against petA or epitope tags

  • ELISA: Develop for quantitative protein measurements

  • Mass Spectrometry: Implement for detailed proteomic analysis and post-translational modification studies

For tick-derived samples, touch-down PCR programs have proven effective, using initially high annealing temperatures that gradually decrease to promote specific amplification and reduce non-specific products .

How does the structure and function of R. bellii petA compare to homologous proteins in other Rickettsia species?

The structure and function of R. bellii petA exhibits both conserved elements and unique features when compared to homologous proteins in other Rickettsia species:

Functional Comparisons:
While the fundamental electron transport function remains conserved across Rickettsia species, R. bellii petA may have adapted specific functional characteristics related to its unique ecological niche. Unlike R. rickettsii (Rocky Mountain spotted fever agent), R. bellii is generally considered less pathogenic to mammals, which may reflect differences in respiratory chain protein functions and their contributions to virulence .

Evolutionary Context:
R. bellii's position as the earliest diverging species of known rickettsiae has significant implications for petA evolution. The protein likely represents a more ancestral form compared to homologues in species like R. typhi, R. conorii, and R. felis . Comparative genomic analyses suggest that R. bellii's petA may have been acquired or retained from ancient genetic exchange events that occurred in a "genetic melting pot" environment, possibly within ancestral amoeba-like protozoa .

What role might petA play in the pathogenicity and host adaptation of R. bellii?

The Ubiquinol-cytochrome c reductase iron-sulfur subunit (petA) likely plays multiple roles in R. bellii's pathogenicity and host adaptation:

Energy Metabolism and Survival:
As a critical component of the electron transport chain, petA is essential for energy production, directly influencing R. bellii's ability to replicate within host cells. This metabolic function would be particularly important during transitions between arthropod vectors and mammalian hosts, where environmental conditions change dramatically .

Infection Capacity:
Experimental data demonstrate that R. bellii can cause clinical or subclinical infections in guinea pigs, with symptoms including fever, orchitis, and dermatitis . The efficiency of the electron transport chain, in which petA functions, may influence the bacterium's capacity to establish infection and proliferate within host tissues.

Intracellular Survival Strategy:
R. bellii has shown remarkable adaptability, capable of multiplying efficiently in the nucleus of eukaryotic cells and surviving in phagocytic amoebae like Acanthamoeba polyphaga . These specialized survival capabilities may be supported by metabolic adaptations involving the respiratory chain, including modifications to petA function.

Host Range Determinant:
R. bellii exhibits the largest arthropod host range among known rickettsiae, being found in both soft and hard ticks . This exceptional versatility may be partially attributable to metabolic adaptability conferred by its respiratory chain components, including petA.

Evolutionary Implications:
R. bellii's petA represents a potential link to ancestral rickettsial metabolism, offering insights into how these bacteria evolved from free-living organisms to obligate intracellular parasites. The protein may retain features that facilitated the original transition to intracellular lifestyles .

How can structural biology approaches be applied to better understand R. bellii petA function?

Advanced structural biology approaches offer powerful tools for elucidating R. bellii petA function:

X-ray Crystallography:

  • Express and purify recombinant petA to ≥95% homogeneity

  • Screen crystallization conditions using sparse matrix approaches

  • Optimize promising conditions for diffraction-quality crystals

  • Collect diffraction data at synchrotron radiation facilities

  • Solve structure using molecular replacement with homologous structures

  • Refine the model to reveal precise arrangement of the iron-sulfur clusters and protein fold

Cryo-Electron Microscopy (Cryo-EM):

  • Prepare recombinant petA samples for vitrification

  • Collect high-resolution image data using direct electron detectors

  • Process data through single-particle analysis pipelines

  • Generate 3D reconstructions at near-atomic resolution

  • Integrate petA structure into the larger context of the cytochrome bc1 complex

Nuclear Magnetic Resonance (NMR) Spectroscopy:

  • Produce isotopically labeled petA protein (15N, 13C)

  • Acquire multidimensional NMR spectra

  • Assign resonances to specific amino acids

  • Determine solution structure through distance and angular constraints

  • Study protein dynamics through relaxation measurements

Computational Approaches:

  • Perform homology modeling based on structural templates

  • Conduct molecular dynamics simulations to study conformational flexibility

  • Implement docking studies with ubiquinol and other potential ligands

  • Apply quantum mechanical calculations to understand electron transfer mechanisms

  • Integrate structural findings with evolutionary analyses to identify functionally important regions

Functional Validation:

  • Design site-directed mutagenesis experiments based on structural insights

  • Create variants with modified iron-sulfur cluster coordination

  • Assess functional impacts through electron transfer activity assays

  • Correlate structural features with pathogenicity in cellular and animal models

What are the major technical challenges in working with recombinant R. bellii petA and how can they be overcome?

Researchers face several significant challenges when working with recombinant R. bellii petA:

Expression and Purification Challenges:

  • Protein Solubility Issues: The membrane-associated nature of petA often leads to aggregation during expression.
    Solution: Optimize expression conditions by testing various detergents, inclusion of solubility-enhancing fusion tags (SUMO, MBP), or using cell-free expression systems that have proven effective for R. bellii proteins .

  • Maintaining Iron-Sulfur Cluster Integrity: The [2Fe-2S] clusters are sensitive to oxidation during purification.
    Solution: Perform all purification steps under anaerobic conditions or with the addition of reducing agents; consider reconstitution of iron-sulfur clusters post-purification.

  • Limited Yield: Membrane proteins often express at low levels.
    Solution: Scale up production using bioreactor systems; optimize codon usage for the expression host; consider specialized expression strains engineered for membrane protein production.

Functional Characterization Challenges:

  • Assay Reproducibility: Electron transfer assays may show high variability.
    Solution: Standardize assay conditions meticulously; use internal controls; perform statistical analysis of multiple replicates.

  • Protein Stability: The protein may lose activity during storage.
    Solution: Test various buffer compositions and storage conditions; consider flash-freezing aliquots in liquid nitrogen with cryoprotectants.

  • Reconstitution in Model Membrane Systems: Achieving proper orientation in artificial membranes.
    Solution: Explore various reconstitution methods including nanodiscs, liposomes, and amphipols to identify optimal systems.

Structural Analysis Challenges:

  • Crystallization Difficulties: Membrane proteins are notoriously difficult to crystallize.
    Solution: Use lipidic cubic phase crystallization; try antibody fragment co-crystallization to provide additional crystal contacts.

  • Cryo-EM Resolution Limitations: The relatively small size of petA (approximately 20-25 kDa) may challenge single-particle cryo-EM approaches.
    Solution: Consider analyzing petA as part of the larger cytochrome bc1 complex; use Fab fragments to increase particle size.

How might genomic approaches advance our understanding of R. bellii petA in the broader evolutionary context?

Genomic approaches offer powerful means to contextualize R. bellii petA within evolutionary frameworks:

Comparative Genomics:

  • Align petA sequences across the Rickettsia genus and broader bacterial taxa to identify:

    • Conserved domains indicating essential functional regions

    • Variable regions suggesting adaptive evolution

    • Signatures of horizontal gene transfer events

  • Analyze synteny patterns surrounding the petA gene to determine if:

    • Its genomic context is conserved across species

    • It was potentially acquired as part of a larger genomic island

    • Regulatory elements show evolutionary conservation

  • Examine R. bellii's unique genomic features in relation to petA function:

    • The non-colinearity of R. bellii's genome compared to other rickettsiae

    • The presence of conjugal DNA transfer genes potentially facilitating horizontal gene transfer

    • Genomic evidence of ancient recombination events

Phylogenomic Analyses:

  • Construct robust phylogenetic trees using:

    • Multiple sequence alignments of petA across diverse bacterial species

    • Whole-genome approaches to place petA evolution in context

    • Protein structure-guided alignments to focus on functionally equivalent regions

  • Apply molecular clock analyses to estimate:

    • When gene duplication or horizontal transfer events occurred

    • The timing of functional divergence in petA across lineages

    • Correlation with major evolutionary transitions in Rickettsia ecology

Functional Genomics:

  • Implement transcriptome analyses to determine:

    • Expression patterns of petA under different environmental conditions

    • Co-expression networks identifying functionally related genes

    • Regulatory mechanisms controlling petA expression

  • Utilize genome editing technologies to:

    • Create petA knockouts or modifications to assess phenotypic impacts

    • Introduce ancestral or variant petA sequences to test functional hypotheses

    • Develop reporter systems to monitor petA activity in vivo

These genomic approaches would help elucidate how R. bellii's petA contributes to its unique position as "the earliest diverging species of known rickettsiae" and may reveal insights into how this protein has shaped the evolution of energy metabolism across the Rickettsia genus.

What are the implications of R. bellii petA research for understanding bacterial pathogenesis and host-microbe interactions?

Research on R. bellii petA has far-reaching implications for understanding bacterial pathogenesis and host-microbe interactions:

Evolutionary Perspective on Pathogenesis:
R. bellii occupies a unique phylogenetic position as the earliest diverging species of known rickettsiae, potentially representing a transitional form between environmental bacteria and obligate intracellular pathogens . Studying its petA provides insights into:

  • The metabolic adaptations that facilitated the shift to intracellular lifestyles

  • How energy metabolism components evolved during the emergence of pathogenicity

  • The role of horizontal gene transfer in acquiring pathogenesis-associated traits

Multi-Host Adaptation Mechanisms:
R. bellii exhibits remarkable versatility, being the only rickettsia found in both soft and hard ticks , while also capable of surviving in amoebae . The petA protein likely contributes to this adaptability by:

  • Supporting metabolic flexibility across diverse host environments

  • Enabling energy production under varying oxygen concentrations and nutrient availabilities

  • Contributing to survival during transitions between arthropod vectors and mammalian hosts

Vector-Pathogen Dynamics:
The research on R. bellii in tick vectors has revealed important insights about rickettsia-tick relationships:

  • R. bellii can be efficiently passed transovarially in ticks, with 100% of Amblyomma dubitatum females passing R. bellii to offspring

  • Primary infection with R. bellii may preclude transovarial transmission of other rickettsial species like R. rickettsii

  • These interactions have significant epidemiological implications for the transmission of more virulent rickettsial pathogens

Novel Interaction Paradigms:
R. bellii's unique ability to multiply efficiently in the nucleus of eukaryotic cells represents an unusual host-pathogen interaction strategy. This nuclear localization may:

  • Provide access to host transcriptional machinery

  • Offer protection from cytoplasmic defense mechanisms

  • Require specialized metabolic adaptations, potentially involving petA function

Therapeutic Target Potential:
Understanding the structure-function relationships of R. bellii petA could inform:

  • Development of targeted antimicrobials that disrupt bacterial energy metabolism

  • Strategies to interfere with rickettsial host adaptation

  • Vaccines targeting conserved epitopes of respiratory chain components

These implications extend beyond Rickettsia to inform broader concepts in microbial pathogenesis, potentially revealing convergent or divergent strategies employed by intracellular pathogens across the bacterial kingdom.

What are the most promising future research directions for R. bellii petA studies?

The most promising future research directions for R. bellii petA studies include:

Structural Biology Integration:

  • Resolving the high-resolution structure of R. bellii petA using advanced approaches like cryo-EM

  • Comparing structural details with homologues from pathogenic Rickettsia species to identify functional adaptations

  • Utilizing structure-guided approaches to understand electron transfer mechanisms at the atomic level

Systems Biology Approaches:

Host-Pathogen Interface:

  • Investigating how petA function relates to R. bellii's ability to multiply in the nucleus of eukaryotic cells

  • Exploring potential interactions between petA and host mitochondrial components during infection

  • Determining if petA functionality influences immune recognition of R. bellii

Evolutionary Perspectives:

  • Reconstructing ancestral petA sequences to test hypotheses about functional evolution

  • Exploring potential horizontal gene transfer events that shaped petA evolution

  • Examining the role of petA in the transition from environmental bacteria to obligate intracellular pathogens

Translational Applications:

  • Evaluating petA as a potential diagnostic marker for R. bellii infection

  • Assessing petA as a target for novel antimicrobial strategies

  • Exploring vaccine development based on conserved epitopes present in petA

These research directions will not only advance our understanding of R. bellii biology but also contribute to broader knowledge about bacterial energy metabolism, pathogen evolution, and host-microbe interactions.

How can interdisciplinary approaches enhance our understanding of R. bellii petA function and evolution?

Interdisciplinary approaches can significantly enhance our understanding of R. bellii petA through synergistic integration of diverse scientific perspectives:

Biophysics-Microbiology Integration:

  • Apply advanced biophysical techniques (EPR spectroscopy, FTIR) to study electron transfer kinetics in the context of bacterial physiology

  • Correlate redox properties with survival capabilities in different host environments

  • Develop mathematical models of electron transport chain efficiency under varying physiological conditions

Evolutionary Biology-Structural Biology Nexus:

  • Map evolutionary conservation onto structural models to identify functionally critical regions

  • Reconstruct ancestral protein sequences and express them to test evolutionary hypotheses

  • Compare structural adaptations across the phylogenetic spectrum of Rickettsia species

Ecology-Molecular Biology Intersection:

  • Relate molecular function of petA to ecological niche exploitation by R. bellii

  • Examine how petA variations correlate with geographic distribution and host range

  • Study how environmental factors influence selection pressures on petA sequence and function

Immunology-Biochemistry Collaboration:

  • Investigate immunogenic properties of petA and its potential role in host immune recognition

  • Determine if antibodies against petA cross-react with host proteins, potentially leading to autoimmunity

  • Explore how petA function might influence bacterial persistence in the face of immune responses

Computational-Experimental Synergy:

  • Use machine learning approaches to predict functional consequences of petA variations

  • Implement molecular dynamics simulations to study conformational dynamics and substrate interactions

  • Design targeted experiments to validate in silico predictions about structure-function relationships

These interdisciplinary approaches can overcome the limitations of single-discipline investigations, providing a more comprehensive understanding of how R. bellii petA functions at multiple biological scales—from molecules to ecosystems.

What are the broader implications of studying R. bellii petA for understanding bacterial adaptation and evolution?

Studying R. bellii petA offers profound insights into fundamental aspects of bacterial adaptation and evolution:

Endosymbiont-to-Pathogen Transition:
R. bellii represents an evolutionary position intermediate between non-pathogenic endosymbionts and virulent pathogens . The petA protein, as a component of core metabolism, serves as a molecular window into how bacteria transitioned from commensal relationships to pathogenic lifestyles. Understanding these transitions has implications for predicting the emergence of new pathogens.

Horizontal Gene Transfer Mechanisms:
R. bellii possesses a complete set of putative conjugal DNA transfer genes and exhibits sex pili-like cell surface appendages . These features suggest active horizontal gene transfer capabilities, which may have shaped the evolution of petA and other metabolic components. This provides insights into how bacterial genomes acquire and integrate new functional modules.

Host-Microbe Co-evolution:
R. bellii's ability to infect diverse hosts, from ticks to amoebae to mammals , makes it an excellent model for studying how metabolic systems adapt to different host environments. The petA protein, central to energy production, likely played a key role in these adaptations, illustrating principles of host-microbe co-evolution applicable across microbial systems.

"Genetic Melting Pot" Hypothesis:
Evidence suggests that amoeba-like ancestral protozoa served as a "genetic melting pot" where rickettsial ancestors exchanged genes with other bacteria . Studying petA in this context illuminates how intracellular niches facilitate genetic exchange and drive bacterial evolution, with implications for understanding the origin of various bacterial lineages.

By studying this ancient rickettsial species and its metabolic components, researchers gain insights not only into Rickettsia evolution but also into broader evolutionary principles that have shaped the diversity of bacterial life on Earth.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.