Recombinant Rickettsia bellii Uncharacterized protein RBE_1264 (RBE_1264)

Shipped with Ice Packs
In Stock

Description

Overview

Recombinant Rickettsia bellii Uncharacterized Protein RBE_1264 (RBE_1264) is a full-length, His-tagged protein produced in Escherichia coli for research applications. Derived from the basal group rickettsial species Rickettsia bellii, this protein (UniProt ID: Q1RH19) spans amino acids 25–673, with a molecular weight corresponding to its 649-residue sequence . While its biological function remains uncharacterized, it is utilized in studies of rickettsial genomics, pathogenesis, and antigenic profiling.

Primary Structure

The protein’s amino acid sequence (649 residues) begins with GFGDSCASLP... and includes conserved domains typical of rickettsial proteins .

PropertyDetails
Host SpeciesRickettsia bellii
Expression SystemE. coli
TagN-terminal His tag
Protein Length649 amino acids (Full-length mature protein: positions 25–673)
Purity>90% (SDS-PAGE verified)
Storage Conditions-20°C/-80°C in Tris/PBS buffer with 6% trehalose (pH 8.0)
Reconstitution Guidelines0.1–1.0 mg/mL in sterile water; 5–50% glycerol for long-term storage

Genomic Context and Phylogenetic Insights

RBE_1264 is encoded in the Rickettsia bellii genome, which is notable for its large size (1.52 Mbp) and high proportion of unique genes lacking orthologues in other Rickettsia species . Comparative genomic analyses reveal:

FeatureR. bellii vs. Other Rickettsia
Genome SizeLargest among sequenced Rickettsia (1.52 Mbp)
Unique Genes324 genes with no orthologues in typhus/spotted fever group species
Repeat Content3.7% repeated DNA sequences (similar to R. felis)
Phylogenetic PositionBasal divergence within Rickettsia, predating pathogenic groups

Geographically distinct R. bellii isolates (North vs. South America) show clade-specific genetic variations, though RBE_1264’s role in these divergences remains unexplored .

Putative Roles

  • Pathogenicity: While R. bellii is not classically pathogenic, genomic studies suggest ancestral interactions with amoebae, potentially facilitating horizontal gene transfer .

  • Motility and Adhesion: R. bellii exhibits actin-based motility influenced by RickA, but RBE_1264’s involvement in this process is unconfirmed .

Research Applications

  • Antigen Production: Used to generate antibodies for proteomic studies.

  • Biochemical Assays: Purity (>90%) and stability make it suitable for structural analyses .

  • Comparative Genomics: Serves as a marker for studying Rickettsia evolution .

Limitations and Future Directions

  • Functional Elucidation: No experimental data directly link RBE_1264 to metabolic or pathogenic pathways.

  • Interaction Networks: Potential partners (e.g., host cell proteins) remain unidentified .

  • Geographic Variation: Whether RBE_1264 exhibits sequence polymorphism across R. bellii clades is unknown .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, should you have specific format requirements, please indicate them during order placement. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
RBE_1264; Uncharacterized protein RBE_1264
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
25-673
Protein Length
Full Length of Mature Protein
Species
Rickettsia bellii (strain RML369-C)
Target Names
RBE_1264
Target Protein Sequence
GFGDSCASLPTTTDGYLESDTAYGYIIRSIDMKAPGGNCDANKPGITFCFKNKDGSSDPC TMYTLNQGDSKKISDLSKDNNPDLGANPILKNIVLTVQTWQNDICLLMPTSRGPMPVACK ALSNPPAPPSVPSCSNIGQSCYTGANYSQSLINFSGLAVQCLKETLDKIFFVGNSCGSQS QSSEITNLTAFPTFQGYLKNAIGAALILYVMFFAFNMVLNKEYGNPDKIALFVIKLLFVT YFSIGLGPLNFNSSQPTQENGMLKYGLPLLTGIAPEFAQIIFNAAGSKGLCVFDTSKYQS GYQFYALWDSIDCRIGYYLGLDLLYNIDKNGVLSSFARGDGGNSSGSIPIPNLGNPDKNS PNALTSVGSLRFFTVMFGFFMAGNVIILISGLVFAVIFLSILLYFITHYLVCMITIYVMT YVSPIFIPMMLFNRTKGYFDGWLKVSLSCALQPAVVAGFIALLITMYDSAIFKNCEFLRY DYEKNNVKFSTFELRLPASSAEVCQESFGYKMLNYYAGKGWEEHLVILFPIKSIAKDVVS ILAELLCVLVFSVIFYYFSKSISQFAADLTNGPKMDAVTASPTKIVDLVKQGAAFIKDAA QATQGKPPSSGDMPGDGGSKRSEGQKGDDSFISSGGNSSGDSLSSSGGK
Uniprot No.

Target Background

Database Links

KEGG: rbe:RBE_1264

Protein Families
TrbL/VirB6 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the basic structural information available for the Rickettsia bellii uncharacterized protein RBE_1264?

RBE_1264 is a full-length protein from Rickettsia bellii strain RmL369-C with UniProt accession number Q1RH19. The protein's expression region spans amino acids 25-673, suggesting it has a signal peptide or other processing at the N-terminus. The complete amino acid sequence contains multiple hydrophobic regions that may indicate membrane-spanning domains, and potential functional motifs can be identified through sequence analysis . The protein appears to have a complex tertiary structure with multiple domains, as suggested by its extensive amino acid sequence, which includes regions rich in glycine, serine, and other amino acids that may contribute to its structural flexibility and functional specificity.

What is known about the phylogenetic context of Rickettsia bellii that produces RBE_1264?

Rickettsia bellii belongs to a basal group of rickettsiae that diverged prior to the pathogenic spotted fever group and typhus group Rickettsia species. It has a diverse representation across more than 25 species of hard and soft ticks throughout the American continent. Phylogenetic studies have revealed a clear separation between isolates from North and South Americas, suggesting continental radiation events in their evolutionary history . The RmL369-C strain, which produces RBE_1264, was isolated from Dermacentor variabilis ticks in the United States and represents one of the well-studied reference strains. Understanding this phylogenetic context is essential for comparative genomic approaches that might help elucidate the function of RBE_1264.

How is recombinant RBE_1264 typically produced for research purposes?

The production of recombinant RBE_1264 involves cloning the coding sequence into an appropriate expression vector, typically with fusion tags to facilitate purification. The protein is expressed in a suitable host system, commonly E. coli, though eukaryotic expression systems may be preferred if post-translational modifications are suspected to be important for function. The recombinant protein is often stored in a Tris-based buffer with 50% glycerol to maintain stability during freeze-thaw cycles . Expression challenges may include protein hydrophobicity, codon usage bias, and potential toxicity to host cells . To overcome these challenges, researchers often optimize codon usage, use strong inducible promoters, and carefully control expression conditions including temperature, induction timing, and media composition.

What methodological approaches can be used to determine the subcellular localization of RBE_1264 in Rickettsia bellii?

Determining the subcellular localization of RBE_1264 requires a multi-faceted approach:

  • Bioinformatic prediction: Initial analysis should use algorithms like PSORT, SignalP, and TMHMM to predict signal peptides, transmembrane domains, and subcellular targeting signals within the amino acid sequence.

  • Fluorescent protein fusion: Creating fusion constructs with fluorescent reporters (GFP, mCherry) at either N- or C-terminus, ensuring the fusion doesn't disrupt targeting signals.

  • Immunolocalization: Developing specific antibodies against RBE_1264 for immunofluorescence microscopy in fixed R. bellii samples.

  • Subcellular fractionation: Separating bacterial components (membrane, cytosol, periplasm) followed by Western blot analysis using anti-RBE_1264 antibodies.

  • Electron microscopy with immunogold labeling: For high-resolution localization, especially if membrane association is suspected based on sequence analysis .

What are the optimal conditions for expressing and purifying recombinant RBE_1264 for functional studies?

Optimizing expression and purification of RBE_1264 requires careful consideration of several factors:

ParameterRecommended ApproachConsiderations
Expression SystemE. coli BL21(DE3) for initial attempts; HEK293 or insect cells if bacterial expression failsBalance between yield, authenticity of structure, and post-translational modifications
Expression VectorpET series with His-tag or GST-tag; dual-tagging may help identify full-length productTags at both N- and C-termini can help distinguish full-length protein from truncated products
Induction ConditionsIPTG concentration of 0.1-0.5 mM; expression at 16-18°C overnightLower temperatures often increase solubility of challenging proteins
Lysis BufferPhosphate or Tris buffer (pH 7.5-8.0) with 150-300 mM NaCl; add protease inhibitorsConsider detergents (0.1% Triton X-100) if membrane association is suspected
Purification StrategyIMAC followed by size exclusion chromatographyTwo-step purification typically yields higher purity
Storage ConditionsTris-based buffer with 50% glycerol at -20°C or -80°C for extended storageAvoid repeated freeze-thaw cycles by creating working aliquots

For challenging proteins like RBE_1264, systematic optimization of these parameters through small-scale expression trials is essential before scaling up production.

What techniques can be employed to study protein-protein interactions involving RBE_1264?

For investigating protein-protein interactions of RBE_1264, researchers should consider multiple complementary approaches:

  • Yeast two-hybrid (Y2H) screening: Using RBE_1264 as bait to screen R. bellii genomic or cDNA libraries, identifying potential interacting partners.

  • Pull-down assays: Utilizing recombinant tagged RBE_1264 to capture interacting proteins from R. bellii lysates, followed by mass spectrometry identification.

  • Co-immunoprecipitation (Co-IP): Similar to case studies with other proteins, where antibodies against RBE_1264 can precipitate the protein along with its binding partners .

  • Cross-linking mass spectrometry: Chemical cross-linking followed by mass spectrometry can capture transient interactions and provide structural information.

  • Biolayer interferometry or surface plasmon resonance: For quantitative analysis of binding affinities and kinetics between purified RBE_1264 and candidate interacting proteins.

  • Proximity labeling methods: BioID or APEX2 fusion proteins can identify proteins in close proximity to RBE_1264 in vivo.

These methods should be applied in combination, as each has strengths and limitations. Validation of identified interactions should include reciprocal experiments and functional assays.

How can researchers determine the potential role of RBE_1264 in Rickettsia bellii pathogenicity and tick-bacteria interactions?

Investigating the role of RBE_1264 in pathogenicity and tick interactions requires a multi-disciplinary approach:

  • Comparative genomics: Analyze presence, conservation, and expression of RBE_1264 homologs across Rickettsia species with different pathogenicity profiles. The phylogenetic analysis methods used for R. bellii strains can be adapted to focus specifically on RBE_1264 sequence variations.

  • Gene knockout or knockdown: CRISPR-Cas systems adapted for Rickettsia or antisense RNA approaches to reduce RBE_1264 expression, followed by assessment of bacterial fitness in different environments.

  • Tick infection models: Compare wild-type R. bellii with RBE_1264-modified strains for their ability to:

    • Colonize different tick tissues

    • Persist through tick developmental stages

    • Transmit between ticks and vertebrate hosts

  • Immunological assays: Test if recombinant RBE_1264 can:

    • Modulate tick or mammalian immune responses

    • Affect tick cell apoptosis or stress responses

    • Interfere with specific signaling pathways

  • Structural predictions: Use AlphaFold2 or similar AI-based tools to predict RBE_1264 structure and identify potential functional domains that might interact with host proteins .

These approaches should be integrated to build a comprehensive understanding of RBE_1264's role in the complex ecology of tick-Rickettsia interactions.

What are the challenges in resolving the three-dimensional structure of RBE_1264, and how can they be addressed?

Resolving the structure of RBE_1264 presents several challenges that require strategic approaches:

ChallengeTechnical SolutionMethodological Approach
Protein size (649 amino acids)Domain identification and expressionBioinformatic prediction of domains followed by construct design and validation
Potential membrane associationDetergent screeningSystematic testing of detergent types and concentrations for optimal solubilization
Expression yieldExpression system optimizationTesting multiple systems (E. coli, yeast, insect cells) and growth conditions
Protein stabilityBuffer optimizationDifferential scanning fluorimetry to identify stabilizing buffer conditions
Crystallization difficultiesAlternative structural methodsCryo-EM for full-length protein; NMR for individual domains
Phase determinationHeavy atom derivativesSelenium-methionine incorporation or heavy metal soaking for X-ray crystallography
Structure validationFunctional assaysSite-directed mutagenesis of key residues identified in the structure

A hybrid approach combining computational predictions, low-resolution experimental techniques (SAXS, negative-stain EM), and high-resolution methods for specific domains may be most successful for this challenging protein.

How can sequence homology and structural predictions be used to infer the potential function of the uncharacterized protein RBE_1264?

Inferring the function of RBE_1264 through bioinformatics requires a systematic approach:

  • Primary sequence analysis:

    • BLAST searches against multiple databases (UniProt, NCBI nr, specialized Rickettsia databases)

    • Analysis of conserved domains using CDD, PFAM, and InterPro

    • Identification of sequence motifs using PROSITE or MEME

  • Secondary structure prediction:

    • Using algorithms like PSIPRED and JPred

    • Prediction of transmembrane regions using TMHMM or Phobius

    • Analysis of disorder regions using IUPred or PONDR

  • Tertiary structure prediction:

    • Ab initio modeling using Rosetta

    • Template-based modeling if distant homologs are identified

    • AI-based prediction using AlphaFold2 or RoseTTAFold

  • Function prediction based on structure:

    • Comparison to structural databases (DALI, VAST)

    • Identification of potential binding pockets or active sites

    • Electrostatic surface analysis for potential nucleic acid binding regions

  • Integrative approach:

    • Combine predictions with experimental context (expression patterns, genomic neighborhood)

    • Consider R. bellii's evolutionary position among Rickettsia species

    • Hypothesize function based on biological needs of intracellular bacteria in tick hosts

This multi-layered approach maximizes the chances of generating testable hypotheses about RBE_1264 function despite its current uncharacterized status.

How might recombinant RBE_1264 be utilized in developing diagnostic tools or vaccines for tick-borne diseases?

The potential applications of RBE_1264 in diagnostics and vaccine development include:

  • Serological diagnostics:

    • Development of ELISA assays using recombinant RBE_1264 to detect antibodies in hosts exposed to R. bellii

    • Creation of protein microarrays including RBE_1264 alongside other rickettsial antigens for differential diagnosis

    • Lateral flow immunoassays for field-deployable tick-borne disease detection

  • Vaccine development strategies:

    • Assessment of RBE_1264 as a potential subunit vaccine component

    • If conserved across Rickettsia species, exploration as a broad-spectrum vaccine candidate

    • Investigation as a carrier protein for delivery of tick antigens in anti-tick vaccines

  • Methodological considerations:

    • Expression systems must be optimized for high-yield, correctly folded protein production

    • Protein stability in various formulations must be established

    • Immunogenicity and protective efficacy require testing in appropriate animal models

  • Challenges to address:

    • Cross-reactivity with other rickettsial proteins must be evaluated

    • Uncharacterized nature of RBE_1264 necessitates thorough safety assessment

    • Cost-effectiveness of recombinant protein production must be considered

Success in these applications would depend on further characterization of RBE_1264's immunogenicity, conservation, and role in bacterial physiology.

What experimental approaches can resolve contradictory data regarding RBE_1264 expression under different environmental conditions?

When faced with contradictory data on RBE_1264 expression, researchers should implement a systematic troubleshooting approach:

  • Standardization of methods:

    • Establish reference materials and controls for quantitative comparisons

    • Implement robust normalization strategies for gene/protein expression analysis

    • Develop standard operating procedures for cultivation, induction, and sample processing

  • Multi-method validation:

    • Compare results from diverse techniques (qRT-PCR, RNAseq, Western blotting, proteomics)

    • Use reporter systems (luciferase, fluorescent proteins) fused to the RBE_1264 promoter

    • Develop specific antibodies for protein detection via multiple methods

  • Systematic variation of conditions:

    • Design factorial experiments to test interactions between variables

    • Use DOE (Design of Experiments) approaches to identify critical parameters

    • Implement time-course studies to capture dynamic expression changes

  • Context-specific considerations:

    • Account for R. bellii strain differences based on phylogeographic distribution

    • Consider host tick species effect on bacterial gene expression

    • Evaluate post-transcriptional and post-translational regulation

  • Data integration:

    • Develop mathematical models to reconcile apparently contradictory observations

    • Use systems biology approaches to place RBE_1264 in broader regulatory networks

    • Consider stochastic gene expression models if variability persists

This methodical approach helps distinguish genuine biological variability from technical artifacts in expression studies.

How can comparative genomic approaches across Rickettsia species inform the functional characterization of RBE_1264?

Comparative genomics offers powerful strategies for understanding RBE_1264:

  • Phylogenetic profiling:

    • Identify presence/absence patterns of RBE_1264 homologs across Rickettsia species

    • Correlate distribution with bacterial lifestyle, host range, and pathogenicity

    • Apply methods similar to those used in R. bellii phylogeographical analysis

  • Synteny analysis:

    • Examine conservation of genomic neighborhood around RBE_1264

    • Identify operonic structures or functionally related gene clusters

    • Compare with related alphaproteobacteria to identify evolutionary patterns

  • Selection pressure analysis:

    • Calculate dN/dS ratios to identify conserved functional domains

    • Identify regions under positive selection that may indicate host-pathogen interfaces

    • Compare across tick-associated and vertebrate-pathogenic Rickettsia species

  • Structural comparison:

    • Predict structures of RBE_1264 homologs across species

    • Identify conserved structural motifs despite sequence divergence

    • Map conservation onto structural models to predict functional regions

  • Integrative analysis:

    • Combine genomic data with transcriptomics from different host environments

    • Correlate with metabolic models to predict functional context

    • Develop testable hypotheses based on patterns of conservation and variation

This comparative approach provides evolutionary context for experimental characterization and can help prioritize specific regions or conditions for functional studies.

What quality control measures should be implemented when working with recombinant RBE_1264 preparations?

Comprehensive quality control for recombinant RBE_1264 requires multiple analytical approaches:

Quality ParameterAnalytical MethodAcceptance Criteria
PuritySDS-PAGE with Coomassie staining>90% single band
IdentityWestern blot with anti-His tag and anti-RBE_1264 antibodiesPositive signal at expected MW
Mass confirmationMass spectrometry (MALDI-TOF or ESI-MS)Within 0.1% of theoretical mass
Endotoxin levelsLAL assay or recombinant Factor C assay<1 EU/mg for research applications
Secondary structureCircular dichroism spectroscopyConsistent spectrum batch-to-batch
Aggregation stateSize exclusion chromatography or DLS<10% high-molecular-weight aggregates
StabilityAccelerated stability studies at various temperaturesMinimal degradation over time
FunctionalityApplication-specific assays based on hypothesized functionReproducible activity in relevant assays
Batch consistencyComparison of critical parameters across batchesCoefficient of variation <15%

Each preparation should be accompanied by a certificate of analysis documenting these parameters, and researchers should establish minimum specifications for their specific applications .

How can researchers troubleshoot expression problems when producing recombinant RBE_1264?

When encountering expression difficulties with RBE_1264, a systematic troubleshooting approach includes:

  • Codon optimization strategies:

    • Analyze the RBE_1264 coding sequence for rare codons in the expression host

    • Test codon-optimized synthetic genes or co-express rare tRNAs

    • Consider different optimization algorithms focused on translation efficiency

  • Expression construct design:

    • Test multiple fusion tags (His, GST, MBP, SUMO) for improved solubility

    • Evaluate different promoter strengths and induction systems

    • Design truncation constructs based on domain predictions if full-length expression fails

  • Host strain selection:

    • Compare standard strains (BL21, Rosetta) with specialized strains for toxic proteins

    • Test eukaryotic expression systems if post-translational modifications are suspected

    • Consider cell-free expression systems for highly toxic proteins

  • Culture conditions optimization:

    • Systematically vary temperature (15-37°C), induction timing, and inducer concentration

    • Test rich vs. minimal media and different carbon sources

    • Implement fed-batch or high-density cultivation techniques

  • Solubility enhancement:

    • Screen buffer additives (salts, detergents, osmolytes) to improve folding

    • Co-express molecular chaperones (GroEL/ES, DnaK/J)

    • Test fusion to solubility-enhancing proteins like MBP or SUMO

Documenting each attempt systematically and analyzing patterns of success/failure can reveal the critical factors affecting RBE_1264 expression.

What are the most effective approaches for developing specific antibodies against RBE_1264 for research applications?

Developing specific antibodies against RBE_1264 requires strategic approaches:

  • Antigen preparation strategies:

    • Full-length recombinant protein if expression is successful

    • Multiple peptide antigens from predicted antigenic regions

    • Domain-specific constructs for targeted antibody generation

  • Immunization protocols:

    • Compare different adjuvants for optimal immune response

    • Implement long-term immunization schedules with multiple boosts

    • Consider DNA immunization followed by protein boosting for challenging antigens

  • Antibody format selection:

    • Polyclonal sera for maximum epitope coverage

    • Monoclonal antibodies for consistency and specificity

    • Recombinant antibody fragments (scFv, Fab) for special applications

  • Screening and validation:

    • Multiple screening methods (ELISA, Western blot, immunoprecipitation)

    • Specificity testing against related proteins and Rickettsia species

    • Validation in multiple applications (immunofluorescence, ChIP, flow cytometry)

  • Optimization strategies:

    • Affinity purification against recombinant protein

    • Negative selection against closely related proteins

    • Epitope mapping to confirm binding to intended regions

Developing a panel of antibodies recognizing different epitopes provides versatility for various applications and increases confidence in results through concordance of findings using different antibodies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.